Passa al contenuto
Merck
Tutte le immagini(7)

Documenti fondamentali

HPA015104

Sigma-Aldrich

Anti-MTDH antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Sinonimo/i:

Anti-3D3/lyric antibody produced in rabbit, Anti-AEG-1 antibody produced in rabbit, Anti-Astrocyte elevated gene-1 protein antibody produced in rabbit, Anti-Lysine-rich CEACAM1 co-isolated protein antibody produced in rabbit, Anti-Metadherin antibody produced in rabbit, Anti-Metastasis adhesion protein antibody produced in rabbit, Anti-Protein LYRIC antibody produced in rabbit

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali


About This Item

Codice UNSPSC:
12352203
Numero Human Protein Atlas:
NACRES:
NA.41
Coniugato:
unconjugated
application:
IF
IHC
Clone:
polyclonal
Reattività contro le specie:
human
citations:
6
tecniche:
immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:200-1:500

Origine biologica

rabbit

Livello qualitativo

Coniugato

unconjugated

Forma dell’anticorpo

affinity isolated antibody

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Nome Commerciale

Prestige Antibodies® Powered by Atlas Antibodies

Stato

buffered aqueous glycerol solution

Reattività contro le specie

human

Convalida avanzata

independent
Learn more about Antibody Enhanced Validation

tecniche

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:200-1:500

Sequenza immunogenica

NSSRHDGKEVDEGAWETKISHREKRQQRKRDKVLTDSGSLDSTIPGIENTITVTTEQLTTASFPVGSKKNKGDSHLNVQVSNFKSGKGDSTLQVSSGLNENLTVNGGGWNEKSVKLSSQISAGEEKWNSVSPA

N° accesso UniProt

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... MTDH(92140)

Cerchi prodotti simili? Visita Guida al confronto tra prodotti

Descrizione generale

MTDH (metadherin) is a transmembrane protein, which spans the membrane once, and has a molecular weight of 64kDa. It is also called astrocyte elevated gene-1 (AEG-1) and lysine-rich CEACAM1 coisolated (LYRIC). It was initially isolated from primary human fetal astrocytes, as a transcript induced by human immunodeficiency virus (HIV)-1. This gene is localized to human chromosome 8q22.1, and is expressed in human brain, with higher expression in neurons as compared to glial cells. This gene has 12 exons and 11 introns.

Immunogeno

Protein LYRIC recombinant protein epitope signature tag (PrEST)

Applicazioni

Anti-MTDH antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Azioni biochim/fisiol

MTDH (metadherin) is highly expressed in multiple cancers such as, esophageal squamous cell carcinoma, hepatocellular carcinoma (HCC), breast, gastric, renal, prostate, colorectal cancer, non-small cell lung cancer, and glioma. It promotes angiogenesis, autophagy, tumor invasion and metastasis. It is responsible for resistance to chemotherapy and tamoxifen, and its up-regulation in invasive breast cancer is related to poor prognosis. In HER2+ breast cancer, it is responsible for resistance to trastuzumab. It chromosomal location is a susceptibility locus to migraine, and thus, this gene might be associated to migraine. It is up-regulated in astrocytomas, and higher the expression level, higher the grade of astrocytoma. Thus, this protein has potential as diagnostic and prognostic marker for astrocytomas. It is essential for the tumorigenesis of hepatocellular carcinoma (HCC), via the activation of NF-κB.

Caratteristiche e vantaggi

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST72055

Stato fisico

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Note legali

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 1

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable

Dispositivi di protezione individuale

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number

Non trovi la versione di tuo interesse?

Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Zhangxiu He et al.
International journal of clinical and experimental pathology, 7(8), 5038-5044 (2014-09-10)
Astrocyte Elevated Gene-1 (AEG-1) has been proposed as a biomarker for a variety of cancers. This study aimed to investigate the expression of AEG-1 in human astrocytomas and the correlation between AEG-1 expression and clinicopathologic variables of astrocytomas. AEG-1 expression
Chadia L Robertson et al.
Cancer research, 74(21), 6184-6193 (2014-09-07)
Activation of the oncogene AEG-1 (MTDH, LYRIC) has been implicated recently in the development of hepatocellular carcinoma (HCC). In mice, HCC can be initiated by exposure to the carcinogen DEN, which has been shown to rely upon activation of NF-κB
Ioanna Giopanou et al.
BioMed research international, 2014, 178410-178410 (2014-06-26)
NF-κB signaling promotes cancer progression in a large number of malignancies. Metadherin, a coactivator of the NF-κB transcription complex, was recently identified to regulate different signaling pathways that are closely related to cancer. We assessed the immunohistochemical expression of p50
Yuka Isozaki et al.
International journal of oncology, 41(3), 985-994 (2012-07-04)
The aim of this study was to determine whether histone acetylation regulates tumor suppressive microRNAs (miRNAs) in esophageal squamous cell carcinoma (ESCC) and to identify genes which are regulated by these miRNAs. We identified a miRNA that was highly upregulated
Cheng Du et al.
BMC cancer, 14, 869-869 (2014-11-25)
Trastuzumab resistance is almost inevitable in the management of human epidermal growth factor receptor (HER) 2 positive breast cancer, in which phosphatase and tensin homolog deleted from chromosome 10 (PTEN) loss is implicated. Since metadherin (MTDH) promotes malignant phenotype of

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.