HPA010817

Anti-FXYD5 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Sinonimo/i: Anti-Dysadherin, Anti-FXYD domain-containing ion transport regulator 5 precursor
• Codice UNSPSC: 12352203
• Numero Human Protein Atlas: HPA010817
• NACRES: NA.41

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: affinity isolated antibody
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Nome Commerciale: Prestige Antibodies^® Powered by Atlas Antibodies
• Forma fisica: buffered aqueous glycerol solution
• Reattività contro le specie: human
• Convalida avanzata: recombinant expression; orthogonal RNAseq; Learn more about Antibody Enhanced Validation
• tecniche: immunoblotting: 0.04-0.4 μg/mL; immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:20-1:50
• Sequenza immunogenica: DTTSSSSADSTIMDIQVPTRAPDAVYTELQPTSPTPTWPADETPQPQTQTQQLEGTDGPLVTDPETHKSTKAAHPTDDTTTLSERPSPSTDVQTDPQTLKPSGFHEDDPFFYDEHTLR
• N° accesso UniProt: Q96DB9
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... FXYD5(53827)

Descrizione

Descrizione generale

FXYD5 (FXYD domain containing ion transport regulator 5) is a cancer-associated glycoprotein localized to the cell surface. It belongs to the family of FXYD proteins, which interacts with and modulate Na,K-ATPase. These proteins span the cell membrane once. The cDNA for this gene codes for a protein of 178 amino acids, containing a single transmembrane domain, a short cytoplasmic tail. It also has a putative O-glycosylated extracellular region as well as a signal peptide. This gene is present with the human chromosome locus 19q13.12. Under normal conditions, it is expressed in only specific tissues. These are generally epithelial tissues such as, lung, kidney and intestine. It is also expressed in normal lymphocytes, as well as in stratified squamous epithelia, in the basal and endothelial cells.

Immunogeno

FXYD domain-containing ion transport regulator 5 precursor recombinant protein epitope signature tag (PrEST)

Applicazioni

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Azioni biochim/fisiol

FXYD5 (FXYD domain containing ion transport regulator 5) is responsible for transcriptionally down-regulating E-cadherin. Therefore, it facilitates tumor invasiveness and metastasis. It is suggested that FXYD5 interacts with actin, and has a role in the formation of microvilli. It is expressed in a wide range of cancer, such as breast, stomach, pancreatic and colon. It is also expressed in head and neck squamous cell carcinoma. It is also expressed in testis, epididymis and ejaculated sperms. In the ejaculated spermatozoa, it co-localizes with E-cadherin and Na,K-ATPase, and therefore, might be a regulator of sperm function. FXYD5 might have potential to determine the prognosis of disease-free survival in stage I NSCLC patients. Its expression level correlates to the risk level of gastrointestinal stromal tumors (GISTs), and thus, may be used for the prognosis of GISTs.

Caratteristiche e vantaggi

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST71700

Stato fisico

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Note legali

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 1
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable
• Dispositivi di protezione individuale: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)