HPA008736

Anti-DAXX antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Sinonimo/i: Anti-Daxx antibody produced in rabbit, Anti-Death domain-associated protein 6 antibody produced in rabbit, Anti-EAP1 antibody produced in rabbit, Anti-ETS1-associated protein 1 antibody produced in rabbit, Anti-Fas death domain-associated protein antibody produced in rabbit, Anti-hDaxx antibody produced in rabbit
• Numero MDL: MFCD01865517
• Codice UNSPSC: 12352203
• Numero Human Protein Atlas: HPA008736
• NACRES: NA.41

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: affinity isolated antibody
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Nome Commerciale: Prestige Antibodies^® Powered by Atlas Antibodies
• Forma fisica: buffered aqueous glycerol solution
• Reattività contro le specie: human
• Convalida avanzata: recombinant expression; RNAi knockdown; orthogonal RNAseq; Learn more about Antibody Enhanced Validation
• tecniche: immunoblotting: 0.04-0.4 μg/mL; immunohistochemistry: 1:200-1:500
• Sequenza immunogenica: DEEEEAAAGKDGDKSPMSSLQISNEKNLEPGKQISRSSGEQQNKGRIVSPSLLSEEPLAPSSIDAESNGEQPEELTLEEESPVSQLFELEIEALPLDTPSSVETDISSSRKQSEEPFTTVLENGAGMVSSTSFNGGVSPHNWGDSG
• N° accesso UniProt: Q9UER7
• applicazioni: research pathology
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... DAXX(1616)

Descrizione

Descrizione generale

DAXX (death-domain associated protein) is a nuclear protein, which is highly conserved in nature. It shuttles between nucleus and cytoplasm. It was originally identified as a FAS-interacting protein, which induces FAS-mediated apoptosis. This gene is localized to human chromosome 6p21.3 in the MHC (major histocompatibility complex) locus. The encoded protein contains FAS-binding region in its C-terminal. It contains two putative nuclear localization signals.

Immunogeno

Death domain-associated protein 6 recombinant protein epitope signature tag (PrEST)

Applicazioni

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Anti-DAXX antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Azioni biochim/fisiol

DAXX (death-domain associated protein) plays essential roles in control of transcription and viral infection and carcinogenesis. It controls multiple signaling pathways involved in cell survival and death. It forms a constitutive constituent of promyleocytic leukaemia protein (PML) nuclear bodies (PML-NBs). In human papillomavirus (HPV)-induced cervical carcinoma, this protein translocates gradually from nucleus to nuclear membrane to cytoplasm to plasma membrane. It acts as a bifunctional protein at centrosomic/pericentrosomic heterochromatin, where it controls the loading of heat shock protein H3.3 under normal conditions and the protection epigenetic identity of heterochromatin during stress conditions. The subcellular localization of this protein determines the sensitivity of macrophages to oxidized low density lipoprotein (ox-LDL), where its nuclear localization can negate the effect of ox-LDL.

Caratteristiche e vantaggi

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST86890

Stato fisico

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Note legali

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 1
• Dispositivi di protezione individuale: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)