HPA006427

ANTI-PLIN3 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Sinonimo/i: Anti-47 kDa MPR-binding protein, Anti-47 kDa mannose 6-phosphate receptor-binding protein, Anti-Cargo selection protein TIP47, Anti-M6PRBP1, Anti-Mannose-6-phosphate receptor-binding protein 1, Anti-PP17, Anti-Placental protein 17
• Codice UNSPSC: 12352203
• Numero Human Protein Atlas: HPA006427
• NACRES: NA.41

Proprietà

• Origine biologica: rabbit
• Coniugato: unconjugated
• Forma dell’anticorpo: affinity isolated antibody
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Nome Commerciale: Prestige Antibodies^® Powered by Atlas Antibodies
• Forma fisica: buffered aqueous glycerol solution
• Reattività contro le specie: human
• Convalida avanzata: RNAi knockdown; Learn more about Antibody Enhanced Validation
• tecniche: immunoblotting: 0.04-0.4 μg/mL; immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:200-1:500
• Sequenza immunogenica: SLGKLRATKQRAQEALLQLSQALSLMETVKQGVDQKLVEGQEKLHQMWLSWNQKQLQGPEKEPPKPEQVESRALTMFRDIAQQLQATCTSLGSSIQGLPTNVKDQVQQARRQVEDLQATFSSIHS
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... M6PRBP1(10226)

Descrizione

Descrizione generale

PLIN3 (perilipin 3) is a lipid droplet-associated protein, which is highly expressed, especially in adipocytes. It is a member of the PAT (perilipin, adipophilin, and the tail-interacting protein) family of proteins, which includes five members. The N-terminal of this protein contains PAT-1 domain, and the C-terminal contains the PAT-2 domain. Both these domains are highly conserved regions. It has a molecular weight of 47kDa.

Immunogeno

Mannose-6-phosphate receptor-binding protein 1 recombinant protein epitope signature tag (PrEST)

Applicazioni

ANTI-PLIN3 antibody produced in rabbit is used for Immuno-precipitation.
Anti-M6PRBP1 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Azioni biochim/fisiol

PLIN3 (perilipin 3) and coatomer GTPases are responsinble for increased oxidation of fat in skeletal muscle tissues, post-exercise and lipolytic stimulation. Thus, in patients with polycystic ovary syndrome (PCOS), these together are involved in the control of lipolysis and triglyceride storage. In neutrophils derived from HL-60 cell line, PLIN3 is responsible for the synthesis of cytoplasmic lipid droplets (LDs). It is also involved in the biogenesis and secretion of prostaglandin E2 (PGE2). It promotes the replication of HIV-1 (human immunodeficiency virus) and vaccinia virus, but inhibits protein synthesis of Sendai virus, thus, acting as a viral restriction factor.

Caratteristiche e vantaggi

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST70468

Stato fisico

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Note legali

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 1
• Dispositivi di protezione individuale: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)