AV50803
Anti-ZNF385B antibody produced in rabbit
affinity isolated antibody
Sinonimo/i:
Anti-FLJ25270, Anti-ZNF533, Anti-Zinc finger protein 385B
Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali
About This Item
Codice UNSPSC:
12352203
NACRES:
NA.41
Prodotti consigliati
Origine biologica
rabbit
Livello qualitativo
Coniugato
unconjugated
Forma dell’anticorpo
affinity isolated antibody
Tipo di anticorpo
primary antibodies
Clone
polyclonal
Stato
buffered aqueous solution
PM
41 kDa
Reattività contro le specie
guinea pig, rabbit, mouse, bovine, horse, human, rat, dog
Concentrazione
0.5 mg - 1 mg/mL
tecniche
western blot: suitable
N° accesso NCBI
N° accesso UniProt
Condizioni di spedizione
wet ice
Temperatura di conservazione
−20°C
modifica post-traduzionali bersaglio
unmodified
Informazioni sul gene
human ... ZNF385B(151126)
Descrizione generale
The gene ZNF385B (Zinc finger protein 385B) is mapped to human chromosome 2q31.2-q31.3. It contains 4 matrin-type zinc fingers. It is present in the germinal center of lymph nodes. ZNF385B is expressed in spleen, lymph node and tonsil.
Immunogeno
Synthetic peptide directed towards the C terminal region of human ZNF385B
Applicazioni
Anti-ZNF385B antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.
Azioni biochim/fisiol
Zinc finger protein 385B (ZNF385B; ZNF533) is a transcription factor. ZNF385B modulates transactivation of p53 and is involved in B-cell apoptosis. The expression of ZNF385B correlates with survival in ovarian carcinomas. Single nucleotide polymorphism in ZNF385B is associated with autism. Similarly, polymorphism in ZNF385B is also linked to nonsyndromic orofacial clefts (NSOC).
Sequenza
Synthetic peptide located within the following region: HVNSEIQLKQHISSRRHKDRVAGKPLKPKYSPYNKLQRSPSILAAKLAFQ
Stato fisico
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Esclusione di responsabilità
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Non trovi il prodotto giusto?
Prova il nostro Motore di ricerca dei prodotti.
Codice della classe di stoccaggio
10 - Combustible liquids
Classe di pericolosità dell'acqua (WGK)
WGK 3
Punto d’infiammabilità (°F)
Not applicable
Punto d’infiammabilità (°C)
Not applicable
Scegli una delle versioni più recenti:
Certificati d'analisi (COA)
Lot/Batch Number
Non trovi la versione di tuo interesse?
Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.
Possiedi già questo prodotto?
I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.
Shuang Liang et al.
Journal of Zhejiang University. Science. B, 15(3), 264-271 (2014-03-07)
A study in a Caucasian population has identified two single-nucleotide polymorphisms (SNPs) in ZNF533, one in DOCK4, and two in IMMP2L, which were all significantly associated with autism. They are located in AUTS1 and AUTS5, which have been identified as
Jun Wu et al.
DNA and cell biology, 30(1), 47-54 (2010-09-21)
The etiology of nonsyndromic orofacial clefts (NSOC) has been considered "complex" or "multifactorial." Etiologic heterogeneity induces disparities in the results among different populations. The zinc finger protein 533 (ZNF533) and several environmental factors have been revealed to be associated with
Bente Vilming Elgaaen et al.
PloS one, 7(9), e46317-e46317 (2012-10-03)
The oncogenesis of ovarian cancer is poorly understood. The aim of this study was to identify mRNAs differentially expressed between moderately and poorly differentiated (MD/PD) serous ovarian carcinomas (SC), serous ovarian borderline tumours (SBOT) and superficial scrapings from normal ovaries
ZNF385B is characteristically expressed in germinal center B cells and involved in B-cell apoptosis.
Kazutoshi Iijima et al.
European journal of immunology, 42(12), 3405-3415 (2012-09-05)
We previously identified zinc finger (ZF) protein ZNF385B as a molecule specifically expressed in Burkitt's lymphoma (BL) among hematologic malignancies. Here, we investigated ZNF385B expression in healthy B cells in a variety of hematological tissues by RT-PCR and immunohistochemistry. ZNF385B
C D Constantinou-Deltas et al.
Genomics, 12(3), 581-589 (1992-03-01)
The zinc finger motif is a highly conserved tandemly repeated sequence of 28-30 amino acids that was first identified in transcription factor TFIIIA from Xenopus laevis. Subsequently, similar motifs were found and characterized in many genes from mammalian genomes and
Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..
Contatta l'Assistenza Tecnica.