Passa al contenuto
Merck
Tutte le immagini(1)

Documenti fondamentali

AV49119

Sigma-Aldrich

Anti-UGT3A2 antibody produced in rabbit

IgG fraction of antiserum

Sinonimo/i:

Anti-MGC119426, Anti-MGC119429, Anti-UDP glycosyltransferase 3 family, polypeptide A2

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali
Tutte le immagini(1)

About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

Origine biologica

rabbit

Livello qualitativo

100

Coniugato

unconjugated

Forma dell’anticorpo

IgG fraction of antiserum

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Forma fisica

buffered aqueous solution

PM

59 kDa

Reattività contro le specie

human

Concentrazione

0.5 mg - 1 mg/mL

tecniche

western blot: suitable

N° accesso NCBI

NP_777574

N° accesso UniProt

Q3SY77

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

Informazioni sul gene

human ... UGT3A2(167127)

Immunogeno

Synthetic peptide directed towards the N terminal region of human UGT3A2

Applicazioni

Anti-UGT3A2 antibody produced in rabbit is suitable for western blotting at a concentration of 2.5μg/ml.

Azioni biochim/fisiol

UDP glycosyltransferase 3 family, polypeptide A2 (UGT3A2) belongs to UDP glycosyltransferase family of enzymes that are involved in the metabolism of small lipophilic compounds. UGT3A2 adds sugars from UDP glucose and UDP xylose to a broad range of substrates to enhance their excretion.

Sequenza

Synthetic peptide located within the following region: HNVTMLNHKRGPFMPDFKKEEKSYQVISWLAPEDHQREFKKSFDFFLEET

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 3

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable

Certificati d'analisi (COA)

Cerca il Certificati d'analisi (COA) digitando il numero di lotto/batch corrispondente. I numeri di lotto o di batch sono stampati sull'etichetta dei prodotti dopo la parola ‘Lotto’ o ‘Batch’.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Peter I MacKenzie et al.
Molecular pharmacology, 79(3), 472-478 (2010-11-23)
The human UDP glycosyltransferase (UGT) 3A family is one of three families involved in the metabolism of small lipophilic compounds. Members of these families catalyze the addition of sugar residues to chemicals, which enhances their excretion from the body. The
Robyn Meech et al.
The Journal of biological chemistry, 287(29), 24122-24130 (2012-05-25)
Recent studies in this laboratory characterized the UGT3A family enzymes, UGT3A1 and UGT3A2, and showed that neither uses the traditional UDP-glycosyltransferase UGT co-substrate UDP-glucuronic acid. Rather, UGT3A1 uses GlcNAc as preferred sugar donor and UGT3A2 uses UDP-Glc. The enzymatic characterization

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.