Passa al contenuto
Merck
Tutte le immagini(2)

Documenti fondamentali

AV48056

Sigma-Aldrich

Anti-ST14 antibody produced in rabbit

affinity isolated antibody

Sinonimo/i:

Anti-HAI, Anti-MT-SP1, Anti-MTSP-1, Anti-MTSP1, Anti-PRSS14, Anti-SNC19, Anti-Suppression of tumorigenicity 14 (colon carcinoma), Anti-TADG-15

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali


About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

Origine biologica

rabbit

Livello qualitativo

Coniugato

unconjugated

Forma dell’anticorpo

affinity isolated antibody

Tipo di anticorpo

primary antibodies

Clone

polyclonal

PM

95 kDa

Reattività contro le specie

pig, human, mouse, bovine, rat, horse

Confezionamento

pkg of 100 μL buffered aqueous solution
pkg of 50 μg lyophilized powder

Concentrazione

0.5 mg - 1 mg/mL

tecniche

immunohistochemistry: suitable
western blot: suitable

N° accesso NCBI

N° accesso UniProt

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... ST14(6768)

Descrizione generale

Suppression of tumorigenicity 14 (colon carcinoma) (ST14) is an intergral membrane serine protease that forms a complex with HAI-1. It is known to inhibit cell growth and functions as a target for miR-27b. Mutations in ST14 have been linked to icthyosis.
Rabbit Anti-ST14 antibody recognizes human, mouse, rat, bovine, and rabbit ST14.

Immunogeno

Synthetic peptide directed towards the C terminal region of human ST14

Applicazioni

Rabbit Anti-ST14 antibody is suitable for western blot applications at a concentration of 0.25 μg/ml and for IHC at 4-8 μg/ml.

Azioni biochim/fisiol

ST14 is an epithelial-derived, integral membrane serine protease. This protease forms a complex with the Kunitz-type serine protease inhibitor, HAI-1, and is found to be activated by sphingosine 1-phosphate. This protease has been shown to cleave and activate hepatocyte growth factor/scattering factor, and urokinase plasminogen activator, which suggest the function of this protease as an epithelial membrane activator for other proteases and latent growth factors. The expression of this protease has been associated with breast, colon, prostate, and ovarian tumors, which implicates its role in cancer invasion, and metastasis.

Sequenza

Synthetic peptide located within the following region: SHVFPAGKAIWVTGWGHTQYGGTGALILQKGEIRVINQTTCENLLPQQIT

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 3

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable


Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number

Non trovi la versione di tuo interesse?

Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Yanfang Wang et al.
The Journal of biological chemistry, 284(34), 23094-23106 (2009-06-24)
MicroRNAs are noncoding, endogenous small RNAs that regulate target genes by cleavage of the targeted mRNA or translational repression. We investigated the microRNAome using 2-color microarrays in a highly invasive human breast cancer cell line, MDA-MB-231 (subline 4175) and a
Thomas Alef et al.
The Journal of investigative dermatology, 129(4), 862-869 (2008-10-10)
Congenital ichthyosis encompasses a heterogeneous group of disorders of cornification. Isolated forms and syndromic ichthyosis can be differentiated. We have analyzed two consanguineous families from the United Arab Emirates and Turkey with an autosomal recessive syndrome of diffuse congenital ichthyosis

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.