Passa al contenuto
Merck
Tutte le immagini(3)

Key Documents

AV46114

Sigma-Aldrich

Anti-APOBEC3B antibody produced in rabbit

affinity isolated antibody

Sinonimo/i:

Anti-APOBEC1L, Anti-ARCD3, Anti-ARP4, Anti-Apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3B, Anti-DJ742C19.2, Anti-FLJ21201, Anti-PHRBNL, Anti-bK150C2.2

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali
Tutte le immagini(3)

About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

Origine biologica

rabbit

Livello qualitativo

100

Coniugato

unconjugated

Forma dell’anticorpo

affinity isolated antibody

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Forma fisica

buffered aqueous solution

PM

46 kDa

Reattività contro le specie

human

Concentrazione

0.5 mg - 1 mg/mL

tecniche

western blot: suitable

N° accesso NCBI

NP_004891

N° accesso UniProt

Q9UH17

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... APOBEC3B(9582)

Immunogeno

Synthetic peptide directed towards the N terminal region of human APOBEC3B

Applicazioni

Anti-APOBEC3B antibody produced in rabbit is suitable for western blotting at a concentration of 0.25μg/ml.

Azioni biochim/fisiol

APOBEC3B is a member of the cytidine deaminase gene family and encodes apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3B. Endogenous APOBEC3B is a principal nuclear protein that facilitates the DNA C-to-U editing activity in breast cancer cell-line extracts. APOBEC3B exhibits antiviral activity against human T-cell leukemia virus type 1 (HTLV-1) and is a potent inhibitor of simian immunodeficiency virus (SIV) replication.

Sequenza

Synthetic peptide located within the following region: NQLPAYKCFQITWFVSWTPCPDCVAKLAEFLSEHPNVTLTISAARLYYYW

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 3

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable

Certificati d'analisi (COA)

Cerca il Certificati d'analisi (COA) digitando il numero di lotto/batch corrispondente. I numeri di lotto o di batch sono stampati sull'etichetta dei prodotti dopo la parola ‘Lotto’ o ‘Batch’.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Marcel Ooms et al.
Journal of virology, 86(11), 6097-6108 (2012-03-30)
The human APOBEC3 family consists of seven cytidine deaminases (A3A to A3H), some of which display potent antiretroviral activity against HIV-1 and other retroviruses. Studies that analyzed the effect of A3G on human T-lymphotropic virus type 1 (HTLV-1) infectivity resulted
Michael B Burns et al.
Nature, 494(7437), 366-370 (2013-02-08)
Several mutations are required for cancer development, and genome sequencing has revealed that many cancers, including breast cancer, have somatic mutation spectra dominated by C-to-T transitions. Most of these mutations occur at hydrolytically disfavoured non-methylated cytosines throughout the genome, and
Qin Yu et al.
The Journal of biological chemistry, 279(51), 53379-53386 (2004-10-07)
In the human genome the apolipoprotein B mRNA-editing enzyme catalytic polypeptide (APOBEC)3 gene has expanded into a tandem array of genes termed APOBEC3A-G. Two members of this family, APOBEC3G and APOBEC3F, have been found to have potent activity against virion

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.