Passa al contenuto
Merck
Tutte le immagini(2)

Documenti fondamentali

AV46106

Sigma-Aldrich

Anti-DFNA5 antibody produced in rabbit

IgG fraction of antiserum

Sinonimo/i:

Anti-Deafness, autosomal dominant 5, Anti-ICERE-1

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali


About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

Origine biologica

rabbit

Livello qualitativo

Coniugato

unconjugated

Forma dell’anticorpo

IgG fraction of antiserum

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Stato

buffered aqueous solution

PM

47 kDa

Reattività contro le specie

human

Concentrazione

0.5 mg - 1 mg/mL

tecniche

immunohistochemistry: suitable
western blot: suitable

N° accesso NCBI

N° accesso UniProt

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... DFNA5(1687)

Immunogeno

Synthetic peptide directed towards the C terminal region of human DFNA5

Applicazioni

Anti-DFNA5 antibody produced in rabbit is suitable for western blotting at a concentration of 1.25μg/ml and for immunohistochemistry at a concentration of 4-8μg/ml.

Azioni biochim/fisiol

DFNA5 gene encodes a protein non-syndromic hearing impairment protein 5 also referred to as autosomal dominant 5 that expresses in foetal cochlea. It plays a pivotal role in apoptosis and cell survival. DFNA5 cooperates with TP53 and facilitates the p53-regulated cellular response to genotoxic stress.

Sequenza

Synthetic peptide located within the following region: AALLGTCCKLQIIPTLCHLLRALSDDGVSDLEDPTLTPLKDTERFGIVQR

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 3

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable


Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number

Non trovi la versione di tuo interesse?

Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Yoshiko Masuda et al.
Journal of human genetics, 51(8), 652-664 (2006-08-10)
The tumor suppressor p53 plays a crucial role in the cellular response to DNA damage by transcriptional activation of numerous downstream genes. Although a considerable number of p53 target genes have been reported, the precise mechanism of p53-regulated tumor suppression
Ken Op de Beeck et al.
European journal of human genetics : EJHG, 19(9), 965-973 (2011-04-28)
DFNA5 was first identified as a gene causing autosomal dominant hearing loss (HL). Different mutations have been found, all exerting a highly specific gain-of-function effect, in which skipping of exon 8 causes the HL. Later reports revealed the involvement of

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.