Passa al contenuto
Merck
Tutte le immagini(2)

Key Documents

AV43930

Sigma-Aldrich

Anti-SLC7A8 antibody produced in rabbit

IgG fraction of antiserum

Sinonimo/i:

Anti-LAT2, Anti-LPI-PC1, Anti-Solute carrier family 7 (cationic amino acid transporter, y+ system), member 8

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali
Tutte le immagini(2)

About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

Origine biologica

rabbit

Livello qualitativo

100

Coniugato

unconjugated

Forma dell’anticorpo

IgG fraction of antiserum

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Forma fisica

buffered aqueous solution

PM

37 kDa

Reattività contro le specie

guinea pig, human, mouse, rat, bovine, rabbit, horse

Concentrazione

0.5 mg - 1 mg/mL

tecniche

western blot: suitable

N° accesso NCBI

NP_036376

N° accesso UniProt

Q9UHI5-2

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... SLC7A8(23428)

Categorie correlate

Immunogeno

Synthetic peptide directed towards the middle region of human SLC7A8

Applicazioni

Anti-SLC7A8 antibody produced in rabbit is suitable for western blotting at a concentration of 1.25μg/ml.

Azioni biochim/fisiol

SLC7A8 also referred to as LAT2 is an L-type neutral amino acid transporter present in the epithelium of kidney proximal tubules and the digestive tract. LAT2 preferentially selects branched-chain amino acids as substrates and transports them across membranes. It has been reported that LAT2 activates the pathway mediated by mammalian target of rapamycin complex 1 (mTORC1) in the glomerular epithelial cells and has a role in the pathogenesis of crescentic glomerulonephritis.

Sequenza

Synthetic peptide located within the following region: PRAIFISIPLVTFVYVFANVAYVTAMSPQELLASNAVAVTFGEKLLGVMA

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 3

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable

Certificati d'analisi (COA)

Cerca il Certificati d'analisi (COA) digitando il numero di lotto/batch corrispondente. I numeri di lotto o di batch sono stampati sull'etichetta dei prodotti dopo la parola ‘Lotto’ o ‘Batch’.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Jonas Zaugg et al.
Journal of cellular and molecular medicine, 24(21), 12681-12693 (2020-10-02)
The placenta supplies the foetus with critical nutrients such as essential amino acids (AA, eg leucine) for development and growth. It also represents a cellular barrier which is formed by a polarized, differentiated syncytiotrophoblast (STB) monolayer. Active Na+ -independent leucine
Caroline Moret et al.
American journal of physiology. Renal physiology, 292(2), F555-F566 (2006-09-28)
The kidney plays a major role in acid-base homeostasis by adapting the excretion of acid equivalents to dietary intake and metabolism. Urinary acid excretion is mediated by the secretion of protons and titratable acids, particularly ammonia. NH(3) is synthesized in
Ryota Kurayama et al.
Laboratory investigation; a journal of technical methods and pathology, 91(7), 992-1006 (2011-03-16)
Molecular mechanisms and signaling pathways leading to cellular proliferation and lesion formation in the crescentic glomerulonephritis (CGN) remain elusive. In the present study we have explored a potential role of the mammalian target of rapamycin complex 1 (mTORC1) signaling pathway
Sun Young Park et al.
Archives of pharmacal research, 28(4), 421-432 (2005-05-28)
In order to understand the renal reabsorption mechanism of neutral amino acids via amino acid transporters, we have isolated human L-type amino acid transporter 2 (hLAT2) and human T-type amino acid transporter 1 (hTAT1) in human, then, we have examined

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.