AV42122

Anti-TST antibody produced in rabbit

affinity isolated antibody

• Sinonimo/i: Anti-MGC19578, Anti-RDS, Anti-Thiosulfate sulfurtransferase (rhodanese)
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: affinity isolated antibody
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Stato: buffered aqueous solution
• PM: 33 kDa
• Reattività contro le specie: bovine, mouse, dog, human, rabbit, horse, rat
• Concentrazione: 0.5 mg - 1 mg/mL
• tecniche: immunohistochemistry: suitable; western blot: suitable
• N° accesso NCBI: NP_003303
• N° accesso UniProt: Q16762
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... TST(7263)

Descrizione

Descrizione generale

Thiosulfate sulfurtransferase (rhodanese) (TST, RDS) is a mitochondrial matrix enzyme that facilitates the modification of sulfur-containing enzymes, and detoxification of H2S and cyanide. Thiosulfate sulfurtransferase converts cyanide into thiocyanide.

Specificità

Anti-TST polyclonal antibody reacts with human, mouse, rat, bovine, canine, and chicken thiosulfate sulfurtransferase/rhodanese enzymes.

Immunogeno

Synthetic peptide directed towards the middle region of human TST

Applicazioni

Anti-TST polyclonal antibody is used to tag thiosulfate sulfurtransferase/rhodanese for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of thiosulfate sulfurtransferase/rhodanese in hydrogen sulfide and cyanide detoxification.

Azioni biochim/fisiol

TST is a mitochondrial matrix enzyme that is encoded by the nucleus. It may play roles in cyanide detoxification, the formation of iron-sulfur proteins, and the modification of sulfur-containing enzymes. The product contains two highly conservative domains (rhodanese homology domains), suggesting these domains have a common evolutionary origin.The product of this gene is a mitochondrial matrix enzyme that is encoded by the nucleus. It may play roles in cyanide detoxification, the formation of iron-sulfur proteins, and the modification of sulfur-containing enzymes. The gene product contains two highly conservative domains (rhodanese homology domains), suggesting these domains have a common evolutionary origin.

Sequenza

Synthetic peptide located within the following region: GEHLGSFYAPRVWWMFRVFGHRTVSVLNGGFRNWLKEGHPVTSEPSRPEP

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 3
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable