AV41640

Anti-SLC22A1 (AB2) antibody produced in rabbit

IgG fraction of antiserum

• Sinonimo/i: Anti-1-Oct, Anti-HOCT1, Anti-Oct1_cds, Anti-Solute carrier family 22 (organic cation transporter), member 1
• Codice UNSPSC: 12352203
• NACRES: NA.41
• Clone: polyclonal
• application: IHC; WB
• Reattività contro le specie: human
• tecniche: immunohistochemistry: suitable; western blot: suitable

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: IgG fraction of antiserum
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Stato: buffered aqueous solution
• PM: 56 kDa
• Reattività contro le specie: human
• Concentrazione: 0.5 mg - 1 mg/mL
• tecniche: immunohistochemistry: suitable; western blot: suitable
• N° accesso NCBI: NP_694857
• N° accesso UniProt: O15245
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• Informazioni sul gene: human ... SLC22A1(6580)

Descrizione

Descrizione generale

Solute carrier family 22 (organic cation transporter), member 1 (SLC22A1, 1-Oct, HOCT1, Oct1-cds) is a transporter of organic cations (OCT) that in addition to endogenous cations include various organic cationic toxins and drugs. Examples of drugs transported by OCT1 include metformin, amantadine, pramipexole, and, possibly, levodopa.

Specificità

Anti-SLC22A1 (AB2) polyclonal antibody reacts with human solute carrier family 22 (organic cation transporter), member 1.

Immunogeno

Synthetic peptide directed towards the C terminal region of human SLC22A1

Applicazioni

Anti-SLC22A1 (AB2) polyclonal antibody is used to tag solute carrier family 22 (organic cation transporter), member 1 protein for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of solute carrier family 22 (organic cation transporter), member 1 in the transport of small organic cations including a variety of important drugs.

Azioni biochim/fisiol

Polyspecific organic cation transporters in the liver, kidney, intestine, and other organs are critical for elimination of many endogenous small organic cations as well as a wide array of drugs and environmental toxins. The protein contains twelve putative transmembrane domains and is a plasma integral membrane protein.Polyspecific organic cation transporters in the liver, kidney, intestine, and other organs are critical for elimination of many endogenous small organic cations as well as a wide array of drugs and environmental toxins. This gene is one of three similar cation transporter genes located in a cluster on chromosome 6. The encoded protein contains twelve putative transmembrane domains and is a plasma integral membrane protein. Two transcript variants encoding two different isoforms have been found for this gene, but only the longer variant encodes a functional transporter.

Sequenza

Synthetic peptide located within the following region: IAIQMICLVNAELYPTFVSGVGPACRGSDATSSRDQGGRFARDHEGRREP

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 3
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable