AV40301

Anti-RAE1 (AB1) antibody produced in rabbit

affinity isolated antibody

• Sinonimo/i: Anti-RAE1 RNA export 1 homolog (S. pombe)
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: affinity isolated antibody
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Forma fisica: buffered aqueous solution
• PM: 40 kDa
• Reattività contro le specie: mouse, guinea pig, rabbit, human, dog, bovine, rat, horse
• Concentrazione: 0.5 mg - 1 mg/mL
• tecniche: immunohistochemistry: suitable; western blot: suitable
• N° accesso NCBI: NP_003601
• N° accesso UniProt: P78406
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... RAE1(8480)

Descrizione

Descrizione generale

RNA export 1 homolog (S. pombe) (RAE1) is involved in the nucleo-cytoplamic transport of mRNA. RAE1 has a novel postmitotic function in neural development via its interaction with RPM-1 (Regulator of Presynaptic Morphology-1) which regulates axon termination and synapse formation. RAE1 is a component of the Highwire (Hiw)/Drosophila Fsn E3 ubiquitin ligase complex required for normal synaptic morphology during development and axonal regeneration after injury. Rae1 restrains synaptic terminal growth by regulating the MAP kinase kinase kinase Wallenda. RNA export factor RAE1 contributes to NUP98-HOXA9-mediated leukemogenesis.

Specificità

Anti-RAE1 (AB1) polyclonal antibody reacts with zebrafish, bovine, canine, human, mouse, rat, chicken, and pig RNA export 1 homolog (S. pombe) proteins.

Immunogeno

Synthetic peptide directed towards the C terminal region of human RAE1

Applicazioni

Anti-RAE1 (AB1) polyclonal antibody is used to tag RNA export 1 homolog (S. pombe) for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles RNA export 1 homolog (S. pombe) in nucleo-cytoplamic transport and the regulation of neural development and leukemogenesis.

Azioni biochim/fisiol

RAE1 is a homolog of yeast Rae1. It contains four WD40 motifs, and has been shown to localize to distinct foci in the nucleoplasm, to the nuclear rim, and to meshwork-like structures throughout the cytoplasm. This gene is thought to be involved in nucleocytoplasmic transport, and in directly or indirectly attaching cytoplasmic mRNPs to the cytoskeleton.Mutations in the Schizosaccharomyces pombe Rae1 and Saccharomyces cerevisiae Gle2 genes have been shown to result in accumulation of poly(A)-containing mRNA in the nucleus, suggesting that the encoded proteins are involved in RNA export. The protein encoded by this gene is a homolog of yeast Rae1. It contains four WD40 motifs, and has been shown to localize to distinct foci in the nucleoplasm, to the nuclear rim, and to meshwork-like structures throughout the cytoplasm. This gene is thought to be involved in nucleocytoplasmic transport, and in directly or indirectly attaching cytoplasmic mRNPs to the cytoskeleton. Alternatively spliced transcript variants encoding the same protein have been found for this gene.

Sequenza

Synthetic peptide located within the following region: EQLDQPISACCFNHNGNIFAYASSYDWSKGHEFYNPQKKNYIFLRNAAEE

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 3
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable