AV39663

Anti-MXD3 antibody produced in rabbit

affinity isolated antibody

• Sinonimo/i: Anti-MAD3, Anti-MAX dimerization protein 3, Anti-MGC2383
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: affinity isolated antibody
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Stato: buffered aqueous solution
• PM: 23 kDa
• Reattività contro le specie: horse, mouse, guinea pig, bovine, rat, human, rabbit, dog
• Concentrazione: 0.5 mg - 1 mg/mL
• tecniche: western blot: suitable
• N° accesso NCBI: NP_112590
• N° accesso UniProt: Q9BW11
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... MXD3(83463)

Descrizione

Descrizione generale

MXD3 is a basic, helix-loop-helix transcription factor that belongs to the MAD family of proteins. This protein is involved in cerebellar development and GNP proliferation. Studies have reported that MXD3 is also required for the proliferation of DAOY medulloblastoma cells.
Rabbit Anti-MXD3 antibody binds to chicken, human, mouse, rat, bovine, zebrafish, and canine MXD3.

Immunogeno

Synthetic peptide directed towards the N terminal region of human MXD3

Applicazioni

Rabbit Anti-MXD3 antibody is suitable for western blot applications at a concentration of 1 μg/ml.

Azioni biochim/fisiol

MXD3 contains 1 basic helix-loop-helix (bHLH) domain. It is a transcriptional repressor and binds with MAX to form a sequence-specific DNA-binding protein complex which recognizes the core sequence 5′-CAC[GA]TG-3′. Antagonizes MYC transcriptional activity by competing for MAX and suppresses MYC dependent cell transformation.

Sequenza

Synthetic peptide located within the following region: MEPLASNIQVLLQAAEFLERREREAEHGYASLCPHRSPGPIHRRKKRPPQ

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 2
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable