Passa al contenuto
Merck
Tutte le immagini(1)

Documenti fondamentali

AV39289

Sigma-Aldrich

Anti-NKRF antibody produced in rabbit

IgG fraction of antiserum

Sinonimo/i:

Anti-NF-kappaB repressing factor

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali


About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

Origine biologica

rabbit

Livello qualitativo

Coniugato

unconjugated

Forma dell’anticorpo

IgG fraction of antiserum

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Stato

buffered aqueous solution

PM

44 kDa

Reattività contro le specie

human, pig, horse, dog

Concentrazione

0.5 mg - 1 mg/mL

tecniche

western blot: suitable

N° accesso NCBI

N° accesso UniProt

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... NKRF(55922)

Descrizione generale

NKRF codes for a nuclear protein that functions as a repressing factor for NF-κB. NKRF suppresses the stimulation of hiNOS, IL-8, IFN, and HIV-1 by NFκB.
Rabbit Anti-NKRF antibody recognizes bovine, human, mouse, rat, and canine NKRF.

Immunogeno

Synthetic peptide directed towards the N terminal region of human NKRF

Applicazioni

Rabbit Anti-NKRF antibody is suitable for western blot applications at a concentration of 2.5 μg/ml.

Azioni biochim/fisiol

NKRF is a transcription factor that interacts with specific negative regulatory elements (NREs) to mediate transcriptional repression of certain NK-kappa-B-responsive genes. NKRF localizes predominantly to the nucleolus with a small fraction found in the nucleoplasm and cytoplasm.This gene encodes a transcription factor that interacts with specific negative regulatory elements (NREs) to mediate transcriptional repression of certain NK-kappa-B-responsive genes. The protein localizes predominantly to the nucleolus with a small fraction found in the nucleoplasm and cytoplasm.

Sequenza

Synthetic peptide located within the following region: MEKILQMAEGIDIGEMPSYDLVLSKPSKGQKRHLSTCDGQNPPKKQAGSK

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 1

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable


Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number

Non trovi la versione di tuo interesse?

Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Yung-Yang Liu et al.
PloS one, 8(6), e66760-e66760 (2013-07-11)
High-tidal-volume mechanical ventilation used in patients with acute lung injury (ALI) can induce the release of inflammatory cytokines, as macrophage inflammatory protein-2 (MIP-2), recruitment of neutrophils, and disruption of alveolar epithelial and endothelial barriers. Induced pluripotent stem cells (iPSCs) have
Gene expression profile of NFκB repressing factor (NKRF) knockdown cells by microarray analysis
Sun, Y., et al.
BioChip Journal, 6(3), 247-253 (2012)

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.