Passa al contenuto
Merck
Tutte le immagini(1)

Documenti fondamentali

AV38110

Sigma-Aldrich

Anti-HMGB1 (AB2) antibody produced in rabbit

IgG fraction of antiserum

Sinonimo/i:

Anti-DKFZp686A04236, Anti-HMG1, Anti-HMG3, Anti-High-mobility group box 1, Anti-SBP-1

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali


About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41
Coniugato:
unconjugated
application:
WB
Clone:
polyclonal
Reattività contro le specie:
guinea pig, mouse, bovine, rat, horse, dog, human, rabbit
citations:
9
tecniche:
western blot: suitable

Origine biologica

rabbit

Livello qualitativo

Coniugato

unconjugated

Forma dell’anticorpo

IgG fraction of antiserum

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Stato

buffered aqueous solution

PM

25 kDa

Reattività contro le specie

guinea pig, mouse, bovine, rat, horse, dog, human, rabbit

Concentrazione

0.5 mg - 1 mg/mL

tecniche

western blot: suitable

N° accesso NCBI

N° accesso UniProt

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... HMGB1(3146)

Immunogeno

Synthetic peptide directed towards the middle region of human HMGB1

Azioni biochim/fisiol

Extracellular HMGB1 is an activator of human tumor cell migration operating in concert with EGF. HMGB1 encodes a protein that is potentially involved in the regulation of lipogenic and cholesterogenic gene transcription.

Sequenza

Synthetic peptide located within the following region: AKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGV

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Raccomandato

N° Catalogo
Descrizione
Determinazione del prezzo

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 1

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable


Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number

Non trovi la versione di tuo interesse?

Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Sok Park et al.
Journal of nutritional science and vitaminology, 60(3), 159-166 (2014-08-01)
Declining renal function is commonly observed with age. Obesity induced by a high-fat diet (HFD) may reduce renal function. Korean red ginseng (KRG) has been reported to ameliorate oxidative tissue injury and have an anti-aging effect. This study was designed
Gang Li et al.
International immunopharmacology, 21(2), 406-411 (2014-05-29)
Hesperidin (HDN) is a citrus bioflavonoid, which widely exists in many plants. Previous researches have proved that HDN has several functions such as anti-oxidant, anti-tumor, anti-inflammatory, immune regulation and so on. In the present study, we explored the protective effects
Kojiro Nakamura et al.
Liver international : official journal of the International Association for the Study of the Liver, 34(10), 1473-1487 (2014-02-07)
Sinusoidal obstruction syndrome (SOS) is a drug-induced liver injury caused by anticancer treatment such as oxaliplatin-based chemotherapy in patients with hepatic colorectal metastases. SOS is also associated with postoperative morbidity after hepatectomy. The aim of this study was to investigate
Fei Lu et al.
International journal of oncology, 45(1), 383-392 (2014-04-24)
Multidrug resistance (MDR) remains the major cause of disease relapse and poor prognosis in adults with acute myeloid leukemia (AML). Emerging evidence shows that drug resistance not only exists against conventional chemotherapeutic drugs, but also limits the efficacy of new
ManKin Choy et al.
The Journal of neuroscience : the official journal of the Society for Neuroscience, 34(26), 8672-8684 (2014-06-27)
A significant proportion of temporal lobe epilepsy (TLE), a common, intractable brain disorder, arises in children with febrile status epilepticus (FSE). Preventative therapy development is hampered by our inability to identify early the FSE individuals who will develop TLE. In

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.