Passa al contenuto
Merck
Tutte le immagini(1)

Key Documents

AV35609

Sigma-Aldrich

Anti-TRPM3 (AB3) antibody produced in rabbit

IgG fraction of antiserum

Sinonimo/i:

Anti-GON-2, Anti-LTRPC3, Anti-MLSN2, Anti-Transient receptor potential cation channel, subfamily M, member 3

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali
Tutte le immagini(1)

About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

Origine biologica

rabbit

Livello qualitativo

100

Coniugato

unconjugated

Forma dell’anticorpo

IgG fraction of antiserum

Tipo di anticorpo

primary antibodies

Clone

polyclonal

PM

188 kDa

Reattività contro le specie

dog, mouse, human, guinea pig, bovine, rat, rabbit, horse

Concentrazione

0.5 mg - 1 mg/mL

tecniche

western blot: suitable

N° accesso NCBI

NP_996829

N° accesso UniProt

Q9HCF6-2

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... TRPM3(80036)

Immunogeno

Synthetic peptide directed towards the N terminal region of human TRPM3

Azioni biochim/fisiol

Transient receptor potential cation channel, subfamily M, member 3 (TRPM3) belongs to the TRP family of channels. These cation-selective channels that regulate homeostasis, calcium signaling, calcium entry and storage.

Sequenza

Synthetic peptide located within the following region: ALVACKLCKAMAHEASENDMVDDISQELNHNSRDFGQLAVELLDQSYKQD

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 3

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable

Certificati d'analisi (COA)

Cerca il Certificati d'analisi (COA) digitando il numero di lotto/batch corrispondente. I numeri di lotto o di batch sono stampati sull'etichetta dei prodotti dopo la parola ‘Lotto’ o ‘Batch’.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

J Oberwinkler et al.
Handbook of experimental pharmacology, (179)(179), 253-267 (2007-01-16)
TRPM3 is the last identified member of the TRPM subfamily and is most closely related to TRPM1. Due to alternative splicing, the TRPM3 gene encodes a large number of different variants. One splice event, affecting the pore-forming region of the
Rika Aoki et al.
Cardiovascular research, 104(2), 326-336 (2014-09-06)
At birth, dynamic changes occur in serum components and haemodynamics, such as closure of the ductus arteriosus (DA). A previous study demonstrated that, in full-term human neonates, serum osmolality decreased transiently after birth, but recovered over the next few days.

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.