AV35259

Anti-P2RX2 (AB1) antibody produced in rabbit

IgG fraction of antiserum

• Sinonimo/i: Anti-Purinergic receptor P2X, ligand-gated ion channel, 2
• Codice UNSPSC: 12352203
• NACRES: NA.41
• Coniugato: unconjugated
• application: IHC; WB
• Clone: polyclonal
• Reattività contro le specie: human
• citations: 2
• tecniche: immunohistochemistry: suitable; western blot: suitable

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: IgG fraction of antiserum
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Stato: buffered aqueous solution
• PM: 42 kDa
• Reattività contro le specie: human
• Concentrazione: 0.5 mg - 1 mg/mL
• tecniche: immunohistochemistry: suitable; western blot: suitable
• N° accesso NCBI: NP_733782
• N° accesso UniProt: Q9UBL9-5
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... P2RX2(22953)

Descrizione

Descrizione generale

P2RX2 (P2X2) is a purinoceptor that functions as an ATP-gated ion channel. The ectodomain movements of this receptor have been analyzed using disulphide locking. In propyl-methanethiosulfonate-attached P2X2 receptors; lipid intercalation can be facilitated between the transmembrane domains during channel opening.
Rabbit Anti-P2RX2 antibody recognizes human and bovine P2RX2.

Immunogeno

Synthetic peptide directed towards the middle region of human P2RX2

Applicazioni

Rabbit Anti-P2RX2 is suitable for western blot (0.6 μg/ml) and IHC (4-8 μg/ml) applications.

Azioni biochim/fisiol

P2RX2 belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel. Binding to ATP mediates synaptic transmission between neurons and from neurons to smooth muscle. Six transcript variants encoding six distinct isoforms have been identified for this gene.

Sequenza

Synthetic peptide located within the following region: LIKNSIHYPKFHFSKGNIADRTDGYLKRCTFHEASDLYCPIFKLGFIVEK

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 1
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable