AV35151

Anti-KCNAB3 antibody produced in rabbit

IgG fraction of antiserum

• Sinonimo/i: Anti-Potassium voltage-gated channel, shaker-related subfamily, β member 3
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: IgG fraction of antiserum
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Forma fisica: buffered aqueous solution
• PM: 44 kDa
• Reattività contro le specie: bovine, guinea pig, horse, rat, dog, rabbit, human
• Concentrazione: 0.5 mg - 1 mg/mL
• tecniche: immunohistochemistry: suitable; western blot: suitable
• N° accesso NCBI: NP_004723
• N° accesso UniProt: O43448
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• Informazioni sul gene: human ... KCNAB3(9196)

Descrizione

Descrizione generale

KCNAB3 codes for a member of potassium voltage-gated channel (shaker-related) protein subfamily. This protein is a β subunit and can form heterodimers that modulate the function of α subunits.
Rabbit Anti-KCNAB3 antibody recognizes rat, canine, human, bovine, and mouse KCNAB3.

Immunogeno

Synthetic peptide directed towards the N terminal region of human KCNAB3

Applicazioni

Rabbit Anti-KCNAB3 antibody is suitable for western blot (0.65 μg/ml) and IHC (4-8 μg/ml) applications.

Azioni biochim/fisiol

Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. Four sequence-related potassium channel genes - shaker, shaw, shab, and shal - have been identified in Drosophila, and each has been shown to have human homolog(s). This gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. This member is one of the beta subunits, which are auxiliary proteins associating with functional Kv-alpha subunits. This member and the KCNA5 gene product assemble into a heteromultimeric A-type channel that inactivates completely and is significantly faster than other A-type Kv channels.

Sequenza

Synthetic peptide located within the following region: RNLGKSGLRVSCLGLGTWVTFGSQISDETAEDVLTVAYEHGVNLFDTAEV

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 3
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable