Passa al contenuto
Merck
Tutte le immagini(2)

Key Documents

AV34704

Sigma-Aldrich

Anti-ZMyND11 (AB1) antibody produced in rabbit

IgG fraction of antiserum

Sinonimo/i:

Anti-BRAM1, Anti-BS69, Anti-MGC111056, Anti-RP11-486H9.1, Anti-Zinc finger, MyND domain containing 11

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali
Tutte le immagini(2)

About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

Origine biologica

rabbit

Livello qualitativo

100

Coniugato

unconjugated

Forma dell’anticorpo

IgG fraction of antiserum

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Forma fisica

buffered aqueous solution

PM

42 kDa

Reattività contro le specie

human, rat, horse, guinea pig, bovine, dog, rabbit, mouse

Concentrazione

0.5 mg - 1 mg/mL

tecniche

immunohistochemistry: suitable
western blot: suitable

N° accesso NCBI

NP_997644

N° accesso UniProt

Q6PJR5

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... ZMYND11(10771)

Descrizione generale

ZMyND11 is a zinc-finger protein that links H3, 3K36me3 to tumor suppression and transcriptional elongation. ZMyND11 has also been implicated in poorly differentiated myeloid leukemia.
Rabbit Anti-ZMyND11 antibody recognizes bovine, chicken, human, mouse, rat, and canine ZMyND11.

Immunogeno

Synthetic peptide directed towards the middle region of human ZMYND11

Applicazioni

Rabbit Anti-ZMyND11 (AB1) antibody is suitable for western blot (2.5 μg/ml) and IHC (4-8 μg/ml) assays.

Azioni biochim/fisiol

ZMYND11 was first identified by its ability to bind the adenovirus E1A protein. The protein localizes to the nucleus. It functions as a transcriptional repressor, and expression of E1A inhibits this repression.

Sequenza

Synthetic peptide located within the following region: SMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNEQLKV

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 3

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable

Certificati d'analisi (COA)

Cerca il Certificati d'analisi (COA) digitando il numero di lotto/batch corrispondente. I numeri di lotto o di batch sono stampati sull'etichetta dei prodotti dopo la parola ‘Lotto’ o ‘Batch’.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Recurrent translocation (10;17)(p15;q21) in acute poorly differentiated myeloid leukemia likely results in ZMYND11-MBTD1 fusion.
Etienne De Braekeleer et al.
Leukemia & lymphoma, 55(5), 1189-1190 (2013-08-07)
Santanu Adhikary et al.
The Journal of biological chemistry, 291(6), 2664-2681 (2015-12-15)
ZMYND8 (zinc finger MYND (Myeloid, Nervy and DEAF-1)-type containing 8), a newly identified component of the transcriptional coregulator network, was found to interact with the Nucleosome Remodeling and Deacetylase (NuRD) complex. Previous reports have shown that ZMYND8 is instrumental in
Hong Wen et al.
Nature, 508(7495), 263-268 (2014-03-05)
Recognition of modified histones by 'reader' proteins plays a critical role in the regulation of chromatin. H3K36 trimethylation (H3K36me3) is deposited onto the nucleosomes in the transcribed regions after RNA polymerase II elongation. In yeast, this mark in turn recruits

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.