AV34040

Anti-RGS16 antibody produced in rabbit

IgG fraction of antiserum

• Sinonimo/i: Anti-Regulator of G-protein signalling 16
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: rabbit
• Coniugato: unconjugated
• Forma dell’anticorpo: IgG fraction of antiserum
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Stato: buffered aqueous solution
• PM: 23 kDa
• Reattività contro le specie: human, mouse, pig, dog, rat
• Concentrazione: 0.5 mg - 1 mg/mL
• tecniche: immunofluorescence: suitable; western blot: suitable
• N° accesso NCBI: NP_002919
• N° accesso UniProt: O15492
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... RGS16(6004)

Descrizione

Descrizione generale

The previously assigned protein identifier Q5VYN9 has been merged into O15492. Full details can be found on the UniProt database.

Immunogeno

Synthetic peptide directed towards the C terminal region of human RGS16

Azioni biochim/fisiol

RGS16 belongs to the ′regulator of G protein signaling′ family. It inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits. It also may play a role in regulating the kinetics of signaling in the phototransduction cascade.

Sequenza

Synthetic peptide located within the following region: DAAQGKTRTLMEKDSYPRFLKSPAYRDLAAQASAASATLSSCSLDEPSHT

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 12 - Non Combustible Liquids
• Classe di pericolosità dell'acqua (WGK): WGK 3
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable