AV32788

Anti-ACADM antibody produced in rabbit

affinity isolated antibody

• Sinonimo/i: Anti-ACAD1, Anti-Acyl-coenzyme A dehydrogenase, C-4 to C-12 straight chain, Anti-MCAD, Anti-MCADH
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: affinity isolated antibody
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Forma fisica: buffered aqueous solution
• PM: 46 kDa
• Reattività contro le specie: human
• Concentrazione: 0.5 mg - 1 mg/mL
• tecniche: western blot: suitable
• N° accesso NCBI: NP_000007
• N° accesso UniProt: P11310
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... ACADM(34)

Descrizione

Descrizione generale

ACADM is an acyl CoA dehydrogenase that catalyzes the first step in the β-oxidation of mitochondrial fatty acids. ACADM mutations have been linked to medium-chain acyl-CoA dehydrogenase deficiency (MCADD) in newborns.
Rabbit Anti-ACADM antibody recognizes bovine, human, mouse, and rat ACADM.

Immunogeno

Synthetic peptide directed towards the N terminal region of human ACADM

Applicazioni

Rabbit Anti-ACADM antibody can be used for western blot applications at a concentration of 1 μg/ml.

Azioni biochim/fisiol

ACADM Is the medium-chain specific (C4 to C12 straight chain) acyl-Coenzyme A dehydrogenase. The homotetramer enzyme catalyzes the initial step of the mitochondrial fatty acid beta-oxidation pathway. Clinical phenotypes are associated with ACADM hereditary deficiency.This gene encodes the medium-chain specific (C4 to C12 straight chain) acyl-Coenzyme A dehydrogenase. The homotetramer enzyme catalyzes the initial step of the mitochondrial fatty acid beta-oxidation pathway. Defects in this gene cause medium-chain acyl-CoA dehydrogenase deficiency, a disease characterized by hepatic dysfunction, fasting hypoglycemia, and encephalopathy, which can result in infantile death. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Sequenza

Synthetic peptide located within the following region: AAGFGRCCRVLRSISRFHWRSQHTKANRQREPGLGFSFEFTEQQKEFQAT

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 3
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable