AV32135

Anti-MyF6 antibody produced in rabbit

affinity isolated antibody

• Sinonimo/i: Anti-MRF4, Anti-Myogenic factor 6 (herculin)
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: affinity isolated antibody
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Forma fisica: buffered aqueous solution
• PM: 27 kDa
• Reattività contro le specie: mouse, guinea pig, sheep, rabbit, horse, rat, goat, bovine, dog, human
• Concentrazione: 0.5 mg - 1 mg/mL
• tecniche: immunohistochemistry: suitable; western blot: suitable
• N° accesso NCBI: NP_002460
• N° accesso UniProt: P23409
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• Informazioni sul gene: human ... MYF6(4618)

Descrizione

Descrizione generale

MyF6 is a possible helix-loop-helix protein that may be involved in muscle differentiation. It is known to have conserved DNA binding and dimerization domains.
Rabbit Anti-MyF6 antibody recognizes canine, human, mouse, rat, bovine, zebrafish, pig, and chicken MyF6.

Immunogeno

Synthetic peptide directed towards the N terminal region of human MYF6

Applicazioni

Rabbit Anti-MyF6 antibody can be used for western blot applications at a concentration of 1μg/ml.

Azioni biochim/fisiol

MYF6 is a part of the myogenic basic helix-loop-helix family of transcription factors, and can activate the muscle differentiation program.

Sequenza

Synthetic peptide located within the following region: PGLQPPHCPGQCLIWACKTCKRKSAPTDRRKAATLRERRRLKKINEAFEA

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 3
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable