AV31839

Anti-PTF1A antibody produced in rabbit

IgG fraction of antiserum

• Sinonimo/i: Anti-Pancreas specific transcription factor, 1a
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: IgG fraction of antiserum
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Forma fisica: buffered aqueous solution
• PM: 35 kDa
• Reattività contro le specie: human
• Concentrazione: 0.5 mg - 1 mg/mL
• tecniche: western blot: suitable
• N° accesso NCBI: NP_835455
• N° accesso UniProt: Q7RTS3
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... PTF1A(256297)

Descrizione

Descrizione generale

PTF1A is a part of the pancreas transcription factor 1 complex that regulates the expression of exocrine pancreas-specific genes. Ptf1a is required for GABAergic neuronal cell fates during spinal cord development. Furthermore, Ptf1a provides a link between the development of inhibitory and excitatory interneurons. Mutations in PTF1A have been associated with diabetes mellitus and cerebellar agenesis.
Rabbit Anti-PTF1A antibody recognizes canine, human, mouse, rat, and zebrafish PTF1A.

Immunogeno

Synthetic peptide directed towards the N terminal region of human PTF1A

Applicazioni

Rabbit Anti-PTF1A antibody can be used for western blot application at a concentration of 2.5μg/ml.

Azioni biochim/fisiol

PTF1A is a pancreas specific transcription factor. Mammalian studies have implicated important roles for the basic helix-loop-helix transcription factor PTF1A-p48 in the development of both exocrine and endocrine pancreas.

Sequenza

Synthetic peptide located within the following region: MDAVLLEHFPGGLDAFPSSYFDEDDFFTDQSSRDPLEDGDELLADEQAEV

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 3
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable