Passa al contenuto
Merck
Tutte le immagini(4)

Documenti fondamentali

AV31375

Sigma-Aldrich

Anti-EN2 antibody produced in rabbit

affinity isolated antibody

Sinonimo/i:

Anti-AUTS1, Anti-AUTS10, Anti-Engrailed homeobox 2

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali


About This Item

Numero MDL:
Codice UNSPSC:
12352203
NACRES:
NA.41

Origine biologica

rabbit

Livello qualitativo

Coniugato

unconjugated

Forma dell’anticorpo

affinity isolated antibody

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Forma fisica

buffered aqueous solution

PM

34 kDa

Reattività contro le specie

dog, mouse, guinea pig, horse, human, rat

Concentrazione

0.5 mg - 1 mg/mL

tecniche

immunohistochemistry: suitable
western blot: suitable

N° accesso NCBI

N° accesso UniProt

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

Informazioni sul gene

human ... EN2(2020)

Descrizione generale

Engrailed homeodomain-containing transcription factors play crucial roles in brain development across many species, including the determination of the hindbrain/midbrain border, cerebellar patterning and aiding in neuronal axon guidance. Engrailed-2 (En-2) gene is expressed across the mesencephalon/metencephalon (mes/met) boundary in the cerebellar primordium. Engrailed-2 is involved in the determination of skeletal muscle physiologic properties. Urinary EN2 is a highly specific and sensitive candidate biomarker of prostate cancer.
Rabbit polyclonal anti-ENS antibody reacts with chicken, zebrafish, human, mouse, and rat engrailed homeobox 2 transcription factors.

Immunogeno

Synthetic peptide directed towards the C-terminal region of Human EN2

Applicazioni

Rabbit Anti-EN2 antibody is suitable for use in western blot (0.5μg/ml) assays.
Rabbit polyclonal anti-ENS antibody is used to tag engrailed homeobox 2 transcription factor for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of engrailed homeobox 2 transcription factor in brain development and skeletal muscle differentiation.

Azioni biochim/fisiol

Homeobox-containing genes are thought to have a role in controlling development. The human engrailed homologs 1 and 2 encode homeodomain-containing proteins and have been implicated in the control of pattern formation during development of the central nervous system.

Sequenza

Synthetic peptide located within the following region: NESQIKIWFQNKRAKIKKATGNKNTLAVHLMAQGLYNHSTTAKEGKSDSE

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 3

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable


Certificati d'analisi (COA)

Cerca il Certificati d'analisi (COA) digitando il numero di lotto/batch corrispondente. I numeri di lotto o di batch sono stampati sull'etichetta dei prodotti dopo la parola ‘Lotto’ o ‘Batch’.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.