Passa al contenuto
Merck
Tutte le immagini(2)

Documenti fondamentali

AV31200

Sigma-Aldrich

Anti-ISGF3G antibody produced in rabbit

affinity isolated antibody

Sinonimo/i:

Anti-IRF-9, Anti-ISGF3, Anti-ISGF3G, Anti-p48

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali


About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41
Clone:
polyclonal
application:
IHC
WB
Reattività contro le specie:
rabbit, human, rat, bovine, mouse, guinea pig, dog, horse
tecniche:
immunohistochemistry: suitable
western blot: suitable
citations:
2

Origine biologica

rabbit

Livello qualitativo

Coniugato

unconjugated

Forma dell’anticorpo

affinity isolated antibody

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Stato

buffered aqueous solution

PM

44 kDa

Reattività contro le specie

rabbit, human, rat, bovine, mouse, guinea pig, dog, horse

Concentrazione

0.5 mg - 1 mg/mL

tecniche

immunohistochemistry: suitable
western blot: suitable

N° accesso NCBI

N° accesso UniProt

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

Informazioni sul gene

human ... ISGF3G(10379)

Categorie correlate

Descrizione generale

Interferon regulatory factor 9 (ISGF3G, IRF-9, p48) is a DNA-binding component of the heterotrimeric transcription factor ISGF3 which is activated by interferon-α and β (type I IFNs). The other two components of ISGF3 are STAT1 and STAT2. ISGF3 gamma or complexes containing ISGF3 gamma are involved in IRF-1-independent pathways mediating IFN gene regulation. ISGF3 plays a primary role in the transmission of a signal from the cell surface to the nucleus via regulatory factors p84/91 and p113.
Rabbit polyclonal anti-ISGF3G antibody reacts with pig, bovine, human, mouse, rat, and zebrafish interferon regulatory factor 9/ISGF3 gamma proteins.

Immunogeno

Synthetic peptide directed towards the N terminal region of human ISGF3G

Applicazioni

Rabbit Anti-ISGF3G antibody can be used for western blotting applications at 2.5μg/ml.
Rabbit polyclonal anti-ISGF3G antibody is used to tag interferon regulatory factor 9/ISGF3 gamma for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of interferon regulatory factor 9/ISGF3 gamma in the mediation of interferon-α and β (type I IFNs) signaling.

Azioni biochim/fisiol

ISGF3G functions to recruit RNA polymerase II to the promoter of interferon-stimulated genes and requires histone deacetylases. Defects in ISGF3 can cause resistance to IFN-.(2a) treatment.

Sequenza

Synthetic peptide located within the following region: PWKHAGKQDFREDQDAAFFKAWAIFKGKYKEGDTGGPAVWKTRLRCALNK

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 3

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable


Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number

Non trovi la versione di tuo interesse?

Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Hou-Zao Chen et al.
The Journal of neuroscience : the official journal of the Society for Neuroscience, 34(36), 11897-11912 (2014-09-05)
The failure of past efforts to develop effective stroke treatments is at least partially because these treatments often interfered with essential physiological functions, even though they are targeted toward pathophysiological events, such as inflammation, excitotoxicity, and oxidative stress. Thus, the
Shinichi Kadota et al.
Nucleic acids research, 42(12), 7642-7653 (2014-06-01)
Chromatin structure and its alteration play critical roles in the regulation of transcription. However, the transcriptional silencing mechanism with regard to the chromatin structure at an unstimulated state of the interferon (IFN)-stimulated gene (ISG) remains unclear. Here we investigated the

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.