Passa al contenuto
Merck
Tutte le immagini(1)

Documenti fondamentali

AV09007

Sigma-Aldrich

Anti-RGS3 antibody produced in rabbit

affinity isolated antibody

Sinonimo/i:

Anti-C2PA, Anti-FLJ20370, Anti-FLJ31516, Anti-FLJ90496, Anti-PDZ-RGS3, Anti-RGP3, Anti-Regulator of G-protein signaling 3

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali
Tutte le immagini(1)

About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

Origine biologica

rabbit

Livello qualitativo

100

Coniugato

unconjugated

Forma dell’anticorpo

affinity isolated antibody

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Forma fisica

buffered aqueous solution

PM

101 kDa

Reattività contro le specie

rat, bovine, pig, human, horse, dog, mouse

Concentrazione

0.5 mg - 1 mg/mL

tecniche

western blot: suitable

N° accesso NCBI

NP_066929

N° accesso UniProt

P49796

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... RGS3(5998)

Categorie correlate

Immunogeno

Synthetic peptide directed towards the C terminal region of human RGS3

Applicazioni

Anti-RGS3 antibody produced in rabbit is suitable for western blotting at a concentration of 0.25 μg/ml.

Azioni biochim/fisiol

Regulator of G-protein signaling-3 (RGS3) accelerates the GTPase activity of G(i) and G(q) subunits. It interacts with the Smad transcription factors that are activated by TGF-β and prevents the heteromerization of Smad3 and Smad4. This results in inhibition of transcriptional activity of Smads and inhibition of TGF-β-induced differentiation of myofibroblasts. In sensory neurons, RGS3 mediates the termination of G protein signaling by calcium influx through voltage-gated channels. The role of RGS3 in collaboration with Ephrin-B is important in the maintenance of the neural progenitor cells.

Sequenza

Synthetic peptide located within the following region: KDNLQSVTRGCFDLAQKRIFGLMEKDSYPRFLRSDLYLDLINQKKMSPPL

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 3

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable

Certificati d'analisi (COA)

Cerca il Certificati d'analisi (COA) digitando il numero di lotto/batch corrispondente. I numeri di lotto o di batch sono stampati sull'etichetta dei prodotti dopo la parola ‘Lotto’ o ‘Batch’.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Runxiang Qiu et al.
Stem cells (Dayton, Ohio), 28(9), 1602-1610 (2010-07-16)
Ephrin-B plays an important role in neural progenitor cells to regulate self-renewal and differentiation. Cellular and embryological evidence suggest this function of ephrin-B is mediated through a PDZ-dependent reverse signaling mechanism. Here, we have genetically investigated the function of PDZ-RGS3
Douglas M Yau et al.
Molecular pharmacology, 73(5), 1356-1361 (2008-02-22)
Regulator of G protein signaling (RGS) proteins are united into a family by the presence of the homologous RGS domain that binds the alpha subunits of heterotrimeric G proteins and accelerates their GTPase activity. A member of this family, RGS3
Patrizia Tosetti et al.
Proceedings of the National Academy of Sciences of the United States of America, 100(12), 7337-7342 (2003-05-29)
G proteins modulate synaptic transmission. Regulators of G protein signaling (RGS) proteins accelerate the intrinsic GTPase activity of Galpha subunits, and thus terminate G protein activation. Whether RGS proteins themselves are under cellular control is not well defined, particularly in

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.