MAB2290
Anti-Integrin α3 Antibody, cytoplasmic domain, clone 29A3
clone 29A3, Chemicon®, from mouse
Sinonimo/i:
CD49c
Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali
About This Item
Codice UNSPSC:
12352203
eCl@ss:
32160702
NACRES:
NA.41
Origine biologica
mouse
Livello qualitativo
Forma dell’anticorpo
purified antibody
Tipo di anticorpo
primary antibodies
Clone
29A3, monoclonal
Reattività contro le specie
human
Produttore/marchio commerciale
Chemicon®
tecniche
immunocytochemistry: suitable
immunohistochemistry: suitable
western blot: suitable
Isotipo
IgG1
N° accesso NCBI
N° accesso UniProt
Condizioni di spedizione
wet ice
modifica post-traduzionali bersaglio
unmodified
Informazioni sul gene
human ... ITGA3(3675)
Descrizione generale
MAB2290 is a mouse monoclonal generated to a synthetic peptide in the cytoplasmic domain of integrin alpha 3A.
Specificità
Anti-integrin alpha 3A (MAB2290) recognizes specifically the cytoplasmic domain of integrin subunit alpha 3A which is present in the basal layer in skin, glomeruli, Bowman′s capsules and distal tubuli in kidney, all vascular and capillary endothlia in brain, heart, and skin, and vascular smooth muscle cells in heart.
SPECIES REACTIVITIES:
Although untested, a braod range of species reactivity is expected due to the conserved nature of the epitope.
SPECIES REACTIVITIES:
Although untested, a braod range of species reactivity is expected due to the conserved nature of the epitope.
Immunogeno
Synthetic peptide corresponding to the cytoplasmic domain of the integrin subunit alpha 3A including an additional N-terminal cysteine: CRTRALYEAKRQKAEMKSQPSETERLTDDY
Applicazioni
Anti-Integrin α3 Antibody, cytoplasmic domain, clone 29A3 is an antibody against Integrin α3 for use in WB, IC, IH.
Western Blot
Immunocytochemistry
Immunohistochemistry (Frozen Sections)
Optimal working dilutions must be determined by the end user.
Immunocytochemistry
Immunohistochemistry (Frozen Sections)
Optimal working dilutions must be determined by the end user.
Stato fisico
Format: Purified
Purified. Liquid in PBS containing 0.01% sodium azide.
Altre note
Concentration: Please refer to the Certificate of Analysis for the lot-specific concentration.
Note legali
CHEMICON is a registered trademark of Merck KGaA, Darmstadt, Germany
Non trovi il prodotto giusto?
Prova il nostro Motore di ricerca dei prodotti.
Raccomandato
N° Catalogo
Descrizione
Determinazione del prezzo
Codice della classe di stoccaggio
12 - Non Combustible Liquids
Classe di pericolosità dell'acqua (WGK)
WGK 2
Punto d’infiammabilità (°F)
Not applicable
Punto d’infiammabilità (°C)
Not applicable
Certificati d'analisi (COA)
Cerca il Certificati d'analisi (COA) digitando il numero di lotto/batch corrispondente. I numeri di lotto o di batch sono stampati sull'etichetta dei prodotti dopo la parola ‘Lotto’ o ‘Batch’.
Possiedi già questo prodotto?
I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.
Canine malignant melanoma alpha-3 integrin binding peptides.
Aina, OH; Maeda, Y; Harrison, M; Zwingenberger, AL; Walker, NJ; Lam, KS; Kent, MS
Veterinary Immunology and Immunopathology null
Frédéric Dallaire et al.
Journal of virology, 83(11), 5329-5338 (2009-03-20)
The human adenovirus E4orf6 and E1B55K proteins promote viral replication by targeting several cellular proteins for degradation. The E4orf6 product has been shown by our group and others to form an E3 ubiquitin ligase complex that contains elongins B and
Frédéric Dallaire et al.
Journal of virology, 83(23), 12172-12184 (2009-09-18)
It has been known for some time that the human adenovirus serotype 5 (Ad5) E4orf6 and E1B55K proteins work in concert to degrade p53 and to regulate selective export of late viral mRNAs during productive infection. Both of these functions
Jake D Howden et al.
BMC biology, 19(1), 130-130 (2021-06-24)
Keratinocytes form the main protective barrier in the skin to separate the underlying tissue from the external environment. In order to maintain this barrier, keratinocytes form robust junctions between neighbouring cells as well as with the underlying extracellular matrix. Cell-cell
Role of integrins in the assembly and function of hensin in intercalated cells.
Vijayakumar, S; Erdjument-Bromage, H; Tempst, P; Al-Awqati, Q
Journal of the American Society of Nephrology null
Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..
Contatta l'Assistenza Tecnica.