HPA047819
Anti-PPP1R17 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Synonym(s):
Anti-C7orf16, Anti-GSBS, Anti-protein phosphatase 1, regulatory subunit 17
Sign Into View Organizational & Contract Pricing
All Photos(5)
About This Item
Recommended Products
biological source
rabbit
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
product line
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
technique(s)
immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:1000-1:2500
immunogen sequence
DRLDKLDPRCSHLDDLSDQFIKDCDLKKKPRKGKNVQATLNVESDQKKPRRKDTPALH
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... PPP1R17(10842)
General description
The gene PPP1R17 (protein phosphatase 1 regulatory subunit 17) is mapped to human chromosome 7p15. The gene encodes for a cGMP (cyclic guanosine monophosphate) dependent protein kinase. It is present in Purkinje cells of the cerebellum.
Immunogen
protein phosphatase 1, regulatory subunit 17 recombinant protein epitope signature tag (PrEST)
Application
All Prestige Antibodies®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Anti-PPP1R17 antibody produced in rabbit has been used in immunohistochemistry.
Anti-PPP1R17 antibody produced in rabbit has been used in immunohistochemistry.
Biochem/physiol Actions
PPP1R17 (protein phosphatase 1 regulatory subunit 17) might be associated with long-term depression. Presence of PPP1R17 in the hypothalamus might also be associated with food intake via the hypothalamo-pituitary-adrenal axis. PPP1R17 variants are linked with hypercholesterolemia.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Linkage
Corresponding Antigen APREST78462
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.
Legal Information
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
10 - Combustible liquids
WGK
WGK 1
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Certificates of Analysis (COA)
Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Comprehensive Classification of Retinal Bipolar Neurons by Single-Cell Transcriptomics.
Shekhar K, et al.
Cell, 166, 1308-1323 (2016)
A promoter SNP (-1323T>C) in G-substrate gene (GSBS) correlates with hypercholesterolemia.
Ono S, et al.
Journal of Human Genetics, 48, 447-450 (2003)
Linkage of genes to total lean body mass in normal women.
Livshits G, et al.
The Journal of Clinical Endocrinology and Metabolism, 92, 3171-3176 (2007)
Caner Caglar et al.
Proceedings of the National Academy of Sciences of the United States of America, 118(13) (2021-03-24)
Leptin-deficient ob/ob mice eat voraciously, and their food intake is markedly reduced by leptin treatment. In order to identify potentially novel sites of leptin action, we used PhosphoTRAP to molecularly profile leptin-responsive neurons in the hypothalamus and brainstem. In addition
Karthik Shekhar et al.
Cell, 166(5), 1308-1323 (2016-08-28)
Patterns of gene expression can be used to characterize and classify neuronal types. It is challenging, however, to generate taxonomies that fulfill the essential criteria of being comprehensive, harmonizing with conventional classification schemes, and lacking superfluous subdivisions of genuine types.
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service