AV48526

Anti-TRMT11 antibody produced in rabbit

affinity isolated antibody

• Synonym(s): Anti-C6orf75, Anti-MDS024, Anti-TRM11, Anti-dJ187J11, Anti-dJ187J11.2, Anti-tRNA methyltransferase 11 homolog (S. cerevisiae)
• UNSPSC Code: 12352203

Properties

• biological source: rabbit
• Quality Level: 100
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 53 kDa
• species reactivity: human, mouse, horse, bovine, dog, rabbit, rat, guinea pig
• concentration: 0.5 mg - 1 mg/mL
• technique(s): western blot: suitable
• NCBI accession no.: NP_001026882
• UniProt accession no.: Q7Z4G4
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... TRMT11(60487)

Description

General description

TRMT11-1 codes for tRNA Methyltransferase 11 homolog (S. cerevisiae). It may be involved in the processing of tRNA. Genetic variation in TRMT11 has been analyzed as a biomarker to predict the efficacy of androgen deprivation therapy in prostate cancer patients.
Rabbit Anti-TRMT11 antibody recognizes human, mouse, rat, chicken, canine, and bovine TRMT11.

Immunogen

Synthetic peptide directed towards the N terminal region of human TRMT11

Application

Rabbit Anti-TRMT11 antibody is suitable for western blot applications at a concentration of 1μg/ml.

Biochem/physiol Actions

TRMT11 belongs to the methyltransferase superfamily. It is a catalytic subunit of an S-adenosyl-L-methionine-dependent tRNA methyltransferase complex that mediates the methylation of the guanosine nucleotide at position 10 (m2G10) in tRNAs.

Sequence

Synthetic peptide located within the following region: IKIHTFNKTLTQEEKIKRIDALEFLPFEGKVNLKKPQHVFSVLEDYGLDP

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable