SAB1412707

Monoclonal Anti-FBN2 antibody produced in mouse

clone 1C2, purified immunoglobulin

• Synonym(s): Anti-CCA, Anti-DA9
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: mouse
• Quality Level: 100
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 1C2, monoclonal
• form: buffered aqueous solution
• mol wt: antigen 36.85 kDa
• species reactivity: human
• technique(s): ELISA: suitable; western blot: 1-5 μg/mL
• isotype: IgG2a
• GenBank accession no.: NM_001999
• UniProt accession no.: P35556
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... FBN2(2201)

Description

General description

The protein encoded by this gene is a component of connective tissue microfibrils and may be involved in elastic fiber assembly. Mutations in this gene cause congenital contractural arachnodactyly. (provided by RefSeq)

Immunogen

FBN2 (NP_001990.2, 2776 a.a. ~ 2876 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
RQKRSIHEPDPTAVEQISLESVDMDSPVNMKFNLSHLGSKEHILELRPAIQPLNNHIRYVISQGNDDSVFRIHQRNGLSYLHTAKKKLMPGTYTLEITSIP

Features and Benefits

Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class Code: 11 - Combustible Solids
• WGK: WGK 1
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable