Skip to Content
Merck
All Photos(4)

Key Documents

AV31655

Sigma-Aldrich

Anti-ESRRG antibody produced in rabbit

IgG fraction of antiserum

Synonym(s):

Anti-Estrogen-related receptor γ

Sign Into View Organizational & Contract Pricing
All Photos(4)

About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

100

conjugate

unconjugated

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

51 kDa

species reactivity

human, rabbit, dog, guinea pig, horse, mouse, bovine, rat

concentration

0.5 mg - 1 mg/mL

technique(s)

immunohistochemistry: suitable
western blot: suitable

NCBI accession no.

NP_001127757

UniProt accession no.

P62508

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... ESRRG(2104)

General description

ESRRG (or ERRgamma) is a transcriptional activator of Dnmt1 expression in humans and mice. This transcription factor has also been implicated in renal papilla development, as well as in lipid and lipoprotein metabolism.
Rabbit ESRRG antibody recognizes bovine, human, mouse, rat, zebrafish, canine, and chicken ESRRG.

Immunogen

Synthetic peptide directed towards the middle region of human ESRRG

Application

Rabbit ESRRG antibody has been used for co-immunoprecipitation and western blot assays. Sigma has verified the use of the product in western blot (0.5μg/ml) and immunohistochemistry (4-8μg/ml, using paraffin-embedded tissue sections) applications.

Biochem/physiol Actions

ERRs, which are coexpressed with ERs in prostatic cells, could regulate cell growth and modulate ER-mediated pathways via interference on ERalpha transcription in prostatic cells. Not only PNRC2 but also the corepressor TLE1 functioned as ERRgamma coactivator in a reporter gene analysis. Transcriptional activation by ERR3 can be ligand-independent.

Sequence

Synthetic peptide located within the following region: RIDAENSPYLNPQLVQPAKKPYNKIVSHLLVAEPEKIYAMPDPTVPDSDI

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

D Sanoudou et al.
The pharmacogenomics journal, 10(3), 165-179 (2009-12-02)
We have used a new ApoA-I transgenic mouse model to identify by global gene expression profiling, candidate genes that affect lipid and lipoprotein metabolism in response to fenofibrate treatment. Multilevel bioinformatical analysis and stringent selection criteria (2-fold change, 0% false
Yuxia Zhang et al.
FEBS letters, 585(9), 1269-1275 (2011-04-05)
We describe a transcriptional mechanism regulating the expression of Dnmt1 by nuclear receptors. We show that ERRγ functions as a transcriptional activator of mouse and human Dnmt1 expression by direct binding to its response elements (ERE1/ERE2) in the dnmt1/DNMT1 promoters.
Rachel Berry et al.
Human molecular genetics, 20(5), 917-926 (2010-12-09)
Congenital anomalies of the kidney and urinary tract (CAKUTs) are common disorders of human development affecting the renal parechyma, renal pelvis, ureter, bladder and urethra; they show evidence of shared genetic aetiology, although the molecular basis of this remains unknown

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service