SAB2102261

Anti-SOD2 antibody produced in rabbit

affinity isolated antibody

• Synonym(s): Anti-IPO-B, Anti-MNSOD, Anti-Superoxide dismutase 2, mitochondrial
• MDL number: MFCD06798545
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: rabbit
• Quality Level: 100
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• mol wt: 24 kDa
• species reactivity: bovine, sheep, rat, dog, goat, human, guinea pig, rabbit
• concentration: 0.5 mg - 1 mg/mL
• technique(s): western blot: suitable
• UniProt accession no.: P04179
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... SOD2(6648)

Description

Immunogen

Synthetic peptide directed towards the N terminal region of human SOD2

Application

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Western Blotting (1 paper)

Sequence

Synthetic peptide located within the following region: MLSRAVCGTSRQLAPVLGYLGSRQKHSLPDLPYDYGALEPHINAQIMQLH

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable