SAB5702286

Anti-Activator protein 2 (AP-2/TFAP2A) Antibody, clone 8I8E4, Rabbit Monoclonal

• Synonym(s): AP-2, AP-2alpha, AP2TF, BOFS, TFAP2
• UNSPSC Code: 12352203

Properties

• biological source: rabbit
• Quality Level: 100
• material: colorless
• clone: 8I8E4, monoclonal
• form: liquid
• mol wt: 48 kDa
• species reactivity: mouse, mouse
• concentration: 2 mg/mL
• technique(s): western blot: 1:500 - 1:2000
• color: colorless
• isotype: IgG
• immunogen sequence: NADFQPPYFPPPYQPIYPQSQDPYSHVNDPYSLNPLHAQPQPQHPGWPGQRQSQESGLLHTHRGLPHQLSGLDPRRDYRRHEDLLHGPHALSSGLGDLSIH
• UniProt accession no.: P05549
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... TFAP2A(7020)

Description

General description

The protein encoded by this gene is a transcription factor that binds the consensus sequence 5'-GCCNNNGGC-3'. The encoded protein functions as either a homodimer or as a heterodimer with similar family members. This protein activates the transcription of some genes while inhibiting the transcription of others. Defects in this gene are a cause of branchiooculofacial syndrome (BOFS). Three transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Dec 2009]

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 50-150 of human Activator protein 2 (AP-2/TFAP2A) (P05549).

PBS with 0.02% sodium azide,0.05% BSA,50% glycerol,pH7.3.

Application

WB

Safety Information

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1