Skip to Content
Merck
All Photos(2)

Key Documents

SAB2103221

Sigma-Aldrich

Anti-ATP6V0D2 antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-ATP6D2, Anti-FLJ38708, Anti-VMA6

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

40 kDa

species reactivity

mouse, human, guinea pig, dog, rabbit, rat

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

General description

Adenosine triphosphatase V0 (ATP6V0D2) is located on human chromosome 8q21. Atp6v0d2 is an isoform of vacuolar (H+) ATPase (v-ATPase) proton pump. ATP6V0D2 is expressed abundantly in mature osteoclasts.

Immunogen

Synthetic peptide directed towards the middle region of human ATP6V0D2

Biochem/physiol Actions

Adenosine triphosphatase V0 (ATP6V0D2) helps in osteoclast maturation and bone formation. Insulin activates ATP6V0D2 through extracellular-signal-regulated kinase (ERK)1/2 pathway.

Sequence

Synthetic peptide located within the following region: MNVLAFNRQFHYGVFYAYVKLKEQEIRNIVWIAECISQRHRTKINSYIPI

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

v-ATPase V 0 subunit d2-deficient mice exhibit impaired osteoclast fusion and increased bone formation
Lee, Seou, et al.
Nature Medicine, 12(12), 1403-1403 (2006)
Insulin enhances RANKL-induced osteoclastogenesis via ERK1/2 activation and induction of NFATc1 and Atp6v0d2
Oh, Ju He, et al.
Cellular Signalling, 27(12), 2325-2331 (2015)
Integrated differential transcriptome maps of Acute Megakaryoblastic Leukemia (AMKL) in children with or without Down Syndrome (DS)
Pelleri,, et al.
BMC Medical Genomics, 7(1), 63-63 (2014)
Na Liu et al.
The Journal of clinical investigation, 129(2), 631-646 (2018-11-16)
Macrophages perform key functions in tissue homeostasis that are influenced by the local tissue environment. Within the tumor microenvironment, tumor-associated macrophages can be altered to acquire properties that enhance tumor growth. Here, we found that lactate, a metabolite found in
Na Liu et al.
Allergy, asthma & immunology research, 13(3), 479-497 (2021-03-19)
Macrophages are important regulators of environmental allergen-induced airway inflammation and asthma. ATP6V0d2 is a subunit of vacuolar ATPase highly expressed in macrophages. However, the functions of ATP6V0d2 in the regulation of pathogenesis of allergic asthma remain unclear. The aim of

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service