Skip to Content
Merck
All Photos(1)

Key Documents

AV35033

Sigma-Aldrich

Anti-ACCN1 antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-Amiloride-sensitive cation channel 1, neuronal (degenerin)

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

63 kDa

species reactivity

human, rabbit, dog, rat, horse

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... ACCN1(40)

General description

ACCN1 (or ASIC2) codes for a protein that belongs to the degenerin/epithelial sodium channel (DEG/ENaC) family. ACCN1 may be involved in neurotransmission. ACCN1 gene may modulate the aggressiveness of neuroblastoma tumors.
Rabbit Anti-ACCN1 antibody recognizes canine, bovine, human, rat, and mouse ACCN1.

Immunogen

Synthetic peptide directed towards the C terminal region of human ACCN1

Application

Rabbit Anti-ACCN1 antibody is suitable for western blot applications at a concentration of 2 μg/ml.

Biochem/physiol Actions

ACCN1 is a member of the degenerin/epithelial sodium channel (DEG/ENaC) superfamily. ACCN1 may play a role in neurotransmission. In addition, a heteromeric association between ACCN1 and ACCN3 (variant 1) has been observed to co-assemble into proton-gated channels sensitive to gadolinium.

Sequence

Synthetic peptide located within the following region: GDIGGQMGLFIGASILTILELFDYIYELIKEKLLDLLGKEEDEGSHDENV

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 2

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Karl Vandepoele et al.
PloS one, 3(5), e2207-e2207 (2008-05-22)
The human 1p36 region is deleted in many different types of tumors, and so it probably harbors one or more tumor suppressor genes. In a Belgian neuroblastoma patient, a constitutional balanced translocation t(1;17)(p36.2;q11.2) may have led to the development of
Xue Sun et al.
Acta biochimica et biophysica Sinica, 46(9), 774-781 (2014-08-01)
Non-steroid anti-inflammatory drugs (NSAIDs) are generally used in the treatment of inflammation and pain through cyclooxygenase (COX) inhibition. Mounting evidence has indicated additional COX-independent targets for NSAIDs including acid-sensing ion channels (ASICs) 1a and 3. However, detailed function and mechanism

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service