Skip to Content
Merck
All Photos(8)

Key Documents

WH0057154M1

Sigma-Aldrich

Monoclonal Anti-SMURF1 antibody produced in mouse

clone 1D7, purified immunoglobulin, buffered aqueous solution

Synonym(s):

Anti-KIAA1625, Anti-SMAD specific E3 ubiquitin protein ligase 1

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

mouse

Quality Level

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

1D7, monoclonal

form

buffered aqueous solution

species reactivity

rat, mouse, human

technique(s)

immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
immunoprecipitation (IP): suitable
indirect ELISA: suitable
indirect immunofluorescence: suitable
western blot: 1-5 μg/mL

isotype

IgG2aκ

GenBank accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... SMURF1(57154)

General description

SMAD specific E3 ubiquitin protein ligase 1 (SMURF1) is an E3 ubiquitin ligase and the gene encoding it is localized on human chromosome 7q22.1.

Immunogen

SMURF1 (NP_065162, 165 a.a. ~ 268 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
DSGPGRPLSCFMEEPAPYTDSTGAAAGGGNCRFVESPSQDQRLQAQRLRNPDVRGSLQTPQNRPHGHQSPELPEGYEQRTTVQGQVYFLHTQTGVSTWHDPRIP

Application

Monoclonal Anti-SMURF1 antibody produced in mouse has been used in Western Blotting.

Biochem/physiol Actions

SMAD specific E3 ubiquitin protein ligase 1 (SMURF1) acts as a negative regulator of transforming growth factor β (TGFβ) pathway. It has a role in the nuclear export of mothers against decapentaplegic homolog 7 (SMAD7) and the degradation of SMAD4. During epithelial-mesenchymal transition, SMURF1 dissolves tight junctions in cells. This protein also has a role in cell migration and in the bone morphogenetic protein pathway. SMURF1 has been associated with hepatocellular carcinoma.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

nwg

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Smurf1 controls S phase progression and tumorigenesis through Wee1 degradation.
Wei R
Febs Letters (2017)
SMURF1 amplification promotes invasiveness in pancreatic cancer.
Kwei KA
PLoS ONE (2011)
Immunolocalization of Smurf1 in Hirano bodies.
Makioka K
Journal of the Neurological Sciences (2014)
[The role of Smad ubiquitination regulatory factor 1 in hepatocellular carcinoma].
Wang X
Zhonghua yi xue yi chuan xue za zhi (Chinese Journal of Medical Genetics) (2012)
Peroxisomal protein PEX13 functions in selective autophagy
Ming Y Lee
EMBO Reports (2016)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service