HPA026761
Anti-EPCAM antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Synonym(s):
Anti Epcam, Anti-Epcam, Epcam Antibody, Epcam Antibody - Anti-EPCAM antibody produced in rabbit, Anti-CD326 antigen, Anti-EGP, Anti-Epithelial cell surface antigen, Anti-Epithelial glycoprotein, Anti-KS 1/4 antigen, Anti-KSA, Anti-Major gastrointestinal tumor-associated protein GA733-2, Anti-Tumor-associated calcium signal transducer 1
Sign Into View Organizational & Contract Pricing
All Photos(6)
About This Item
Recommended Products
biological source
rabbit
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
product line
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
enhanced validation
orthogonal RNAseq
recombinant expression
Learn more about Antibody Enhanced Validation
technique(s)
immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:200-1:500
immunogen sequence
LFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYY
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... EPCAM(4072)
General description
Epithelial cell adhesion molecule (EpCAM) gene, also referred to as TACSTD (tumor-associated calcium signal transducer) 1, is mapped to human chromosome 2p21, a region composed of the mutS homolog 2 (MSH2) and mutS homolog 6 (MSH6) DNA mismatch repair genes. The gene codes for a membrane-associated glycoprotein expressed in epithelial cells of different organs.
Immunogen
Tumor-associated calcium signal transducer 1 Precursor recombinant protein epitope signature tag (PrEST)
Application
All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Anti-EPCAM antibody produced in rabbit has been used in proximity ligation assay to study the interaction between EpCAM and AGR2 (anterior gradient-2 ) proteins.
Biochem/physiol Actions
Epithelial cell adhesion molecule (EpCAM) might function as a hepatic stem/progenitor cell-specific marker. EpCAM is an oncogene activated by deliverance of its intracellular domain, which is involved in transducing signals into the cell nucleus by associating with elements of the wnt pathway. Since the epithelial cell adhesion molecule (EpCAM) is highly expressed in premalignant hepatic tissues and in a subset of hepatocellular carcinoma (HCC), it might act as an early biomarker of hepatocellular carcinoma (HCC). EpCAM gene mutation leads to a rare autosomal recessive diarrheal disorder in infants called congenital tufting enteropathy (CTE). Like other cell adhesion molecules, EpCAM plays a crucial role in cell-cell interaction and it is also associated with tight junction protein, like claudin-7. Experimental studies hypothesize that EpCAM is involved in normal intestinal and crypt villus axis development .
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Linkage
Corresponding Antigen APREST70142
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Legal Information
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
10 - Combustible liquids
WGK
WGK 1
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Certificates of Analysis (COA)
Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Customers Also Viewed
Absence of cell-surface EpCAM in congenital tufting enteropathy.
Schnell U
Human Molecular Genetics, 22(13), 2566-2571 (2013)
Noëlla Lopes et al.
Nature communications, 9(1), 1262-1262 (2018-03-30)
Medullary thymic epithelial cells (mTEC) purge the T cell repertoire of autoreactive thymocytes. Although dendritic cells (DC) reinforce this process by transporting innocuous peripheral self-antigens, the mechanisms that control their thymic entry remain unclear. Here we show that mTEC-CD4+ thymocyte
Chiara Nicolazzo et al.
Cancers, 11(8) (2019-07-28)
Molecular alterations are not randomly distributed in colorectal cancer (CRC), but rather clustered on the basis of primary tumor location underlying the importance of colorectal cancer sidedness. We aimed to investigate whether circulating tumor cells (CTC) characterization might help clarify
Identification of microRNA-181 by genome-wide screening as a critical player in EpCAM-positive hepatic cancer stem cells.
Ji J
Hepatology, 50(2), 472-480 (2009)
The emerging role of EpCAM in cancer and stem cell signaling.
Cancer Research, 69(14), 5627-5629 (2009)
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service