Skip to Content
Merck
All Photos(2)

Key Documents

AV40182

Sigma-Aldrich

Anti-HOMER1 (AB2) antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-HOMER1A, Anti-HOMER1B, Anti-HOMER1C, Anti-Homer homolog 1 (Drosophila), Anti-SYN47, Anti-Ves-1

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

39 kDa

species reactivity

pig, rabbit, human, rat, dog, horse, bovine, mouse

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... HOMER1(9456)

General description

Homer proteins are cytoplasmic adaptor proteins that contain the Ena/VASP homology 1 domain that binds to the PPXXF sequence motifs found in Ca2+ handling proteins such as IP3 receptors, transient receptor potential canonical (TRPC) channels and ryanodine receptor (RyR) Ca2+ release channels. HOMER1, a calcium signaling complex modulator, is involved in the opening and closing of TRPC channels such as the endoplasmic reticulum store-operated Ca2+ -influx channels (SOCs). Homer1 plays a critical role in determining the apoptotic susceptibility to TRAIL, an apoptotic cell death-inducing ligand that belongs to a TNF superfamily.

Specificity

Anti-HOMER1 (AB2) polclonal antibody reacts with canine, human, mouse, rat, and bovine homer 1 adaptor proteins.

Immunogen

Synthetic peptide directed towards the N terminal region of human HOMER1

Application

Anti-HOMER1 (AB2) polclonal antibody is used to tag the homer 1 for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of homer 1 as a modulator of calcium transport and signaling involved in apoptosis, body movement and various cellular processes.

Biochem/physiol Actions

HOMER1 is a member of the homer family of dendritic proteins. Members of this family regulate group 1 metabotrophic glutamate receptor function.This gene encodes a member of the homer family of dendritic proteins. Members of this family regulate group 1 metabotrophic glutamate receptor function.This gene encodes a member of the homer family of dendritic proteins. Members of this family regulate group 1 metabotrophic glutamate receptor function.

Sequence

Synthetic peptide located within the following region: EKFQEFKEAARLAKEKSQEKMELTSTPSQESAGGDLQSPLTPESINGTDD

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service