Skip to Content
Merck
All Photos(2)

Key Documents

AV32263

Sigma-Aldrich

Anti-ETV4 antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-Ets variant gene 4 (E1A enhancer binding protein, E1AF)

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

54 kDa

species reactivity

mouse, rat, human, pig, bovine

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... ETV4(2118)

General description

ETS variant gene 4 (ETV4, E1AF) is a transcription factor that regulates cell motility and invasiveness. It confers an invasive (metastatic) phenotype on various cancer cells via activation of genes such involved in cell mobilization such as HER2/neu and various matrix metalloproteinases. ETV4/E1AR activates the Rho/Rho-associated kinase pathway.
Rabbit polyclonal anti-ETV4 antibody reacts with bovine, mouse, human, and rat ETS variant gene 4 (E1A enhancer binding protein, E1AF) transcription factors.

Immunogen

Synthetic peptide directed towards the middle region of human ETV4

Application

Rabbit Anti-ETV4 antibody has been used for immunofluorescence applications at 1:200 dilution using formaldehyde-fixed cells. The antibody can also be used for western blot applications at 0.5μg/ml.
Rabbit polyclonal anti-ETV4 antibody is used to tag ETS variant gene 4 (E1A enhancer binding protein, E1AF) transcription factor for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of ETS variant gene 4 (E1A enhancer binding protein, E1AF) transcription factor in cell mobilization and tumor metastasis/invasivness.

Biochem/physiol Actions

The protein encoded by the ETV4 gene is known to play a role in ovarian and breast malignancies as well as in the early stage of colorectal carcinogenesis.

Sequence

Synthetic peptide located within the following region: HSSVFQQPLDICHSFTSQGGGREPLPAPYQHQLSEPCPPYPQQSFKQEYH

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Annalisa Lorenzato et al.
Experimental cell research, 319(17), 2627-2636 (2013-08-21)
The human homolog of the yeast cse1 gene (CSE1L) is over-expressed in ovarian cancer. CSE1L forms complex with Ran and importin-α and has roles in nucleocytoplasmic traffic and gene expression. CSE1L accumulated in the nucleus of ovarian cancer cell lines

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service