Skip to Content
Merck
All Photos(3)

Key Documents

WH0007038M1

Sigma-Aldrich

Monoclonal Anti-TG antibody produced in mouse

clone 1G3, purified immunoglobulin, buffered aqueous solution

Synonym(s):

Anti-AITD3, Anti-thyroglobulin

Sign Into View Organizational & Contract Pricing


About This Item

MDL number:
UNSPSC Code:
12352203
NACRES:
NA.41

biological source

mouse

Quality Level

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

1G3, monoclonal

form

buffered aqueous solution

species reactivity

human

technique(s)

immunofluorescence: suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

isotype

IgG1κ

GenBank accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... TG(7038)

Related Categories

General description

Thyroglobulin (TG) is a 660 kDa homodimeric glycoprotein, secreted by endoplasmic reticulum. The gene is located on human chromosome 8q24.22. It is majorly expressed in thyroid gland.

Immunogen

TG (NP_003226, 2659 a.a. ~ 2768 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
FSHFIRSGNPNYPYEFSRKVPTFATPWPDFVPRAGGENYKEFSELLPNRQGLKKADCSFWSKYISSLKTSADGAKGGQSAESEEEELTAGSGLREDLLSLQEPGSKTYSK

Biochem/physiol Actions

Thyroglobulin (TG) regulates iodide storage and synthesis of thyroid hormones, thyroxine (T4) and triiodothyronine (T3). Mutations in TG is associated with goiter and congenital hypothyroidism. Polymorphisms in this gene is linked to autoimmune thyroid diseases (AITD) like, Graves′ disease and Hashimoto thyroiditis.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Association of the polymorphisms in the gene encoding thyroglobulin with the development and prognosis of autoimmune thyroid disease
Mizuma T, et al.
Autoimmunity, 50(6), 386-392 (2017)
Thyroglobulin from molecular and cellular biology to clinical endocrinology
Di JB and Arvan P
Endocrine Reviews, 37(1), 2-36 (2015)
Thyroglobulin gene mutations in Chinese patients with congenital hypothyroidism
Hu X, et al.
Molecular and Cellular Endocrinology, 423, 60-66 (2016)
Novel mutational mechanism in the thyroglobulin gene: imperfect DNA inversion as a cause for hereditary hypothyroidism
Citterio CE, et al.
Molecular and Cellular Endocrinology, 381(1-2), 220-229 (2013)
Stephanie Smooke-Praw et al.
Clinical endocrinology, 81(2), 271-275 (2014-02-06)
Thyroglobulin antibodies (TgAb) are present in approximately 20% of patients with papillary thyroid cancer (PTC) and invalidate the serum thyroglobulin (Tg) level as a tumour marker. We examined whether trends in the TgAb level could serve as a surrogate marker

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service