SAB5702155

Anti-NeuN Antibody, clone 3M5M9, Rabbit Monoclonal

• Synonym(s): FOX-3,FOX3,HRNBP3,NEUN,NeuN,RBFOX3
• UNSPSC Code: 12352203

Properties

• biological source: rabbit
• Quality Level: 100
• material: colorless
• clone: 3M5M9, monoclonal
• form: liquid
• mol wt: 46-55 kDa
• species reactivity: rat, rat, human
• concentration: 1.00 mg/mL
• technique(s): immunofluorescence: 1:50 - 1:200; immunohistochemistry: 1:50 - 1:200; western blot: 1:500 - 1:1000
• color: colorless
• isotype: IgG
• immunogen sequence: MAQPYPPAQYPPPPQNGIPAEYAPPPPHPTQDYSGQTPVPTEHGMTLYTPAQTHPEQPGSEASTQPIAGTQTVPQTDEAAQTDSQPLHPSDPTEKQQPKR
• UniProt accession no.: A6NFN3
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... RBFOX3(146713)

Description

General description

This gene encodes a member of the RNA-binding FOX protein family which is involved in the regulation of alternative splicing of pre-mRNA. The protein has an N-terminal proline-rich region, an RNA recognition motif (RRM) domain, and a C-terminal alanine-rich region. This gene produces the neuronal nuclei (NeuN) antigen that has been widely used as a marker for post-mitotic neurons. This gene has its highest expression in the central nervous system and plays a prominent role in neural tissue development and regulation of adult brain function. Mutations in this gene have been associated with numerous neurological disorders. Alternative splicing of this gene results in multiple transcript variants encoding distinct isoforms.

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human NeuN (A6NFN3).

PBS with 0.05% proclin300,0.05% BSA,50% glycerol,pH7.3.

Application

WB, IHC, IF/ICC

Safety Information

• Pictograms: GHS07,GHS09
• Signal Word: Warning
• Hazard Statements: H317 - H411
• Precautionary Statements: P261 - P272 - P273 - P280 - P302 + P352 - P333 + P313
• Hazard Classifications: Aquatic Chronic 2 - Skin Sens. 1
• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3