HPA029691
Anti-SIRT4 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution, ab1
Synonym(s):
Anti-SIR2L4, Anti-sirtuin (silent mating type information regulation 2 homolog) 4 (S. cerevisiae)
Sign Into View Organizational & Contract Pricing
All Photos(3)
About This Item
Recommended Products
biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
product line
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
enhanced validation
recombinant expression
Learn more about Antibody Enhanced Validation
technique(s)
immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:50-1:200
immunogen sequence
VLQERFQVLNPTWSAEAHGLAPDGDVFLSEEQVRSFQVPTCVQCGGHLKPDVVFFGDTVNPDKVDFVHKRVKEADSLLVVGS
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... SIRT4(23409)
General description
SIRT4 (sirtuin 4) belongs to sirtuin family of nicotinamide adenine dinucleotide-dependent enzymes. It is a NAD+-dependent ADP ribosyltransferase, that is located in the mitochondria. SIRT4 protein level is found to be more in ESCC (esophageal squamous cell carcinoma) tissues.
Immunogen
sirtuin (silent mating type information regulation 2 homolog) 4 (S. cerevisiae) recombinant protein epitope signature tag (PrEST)
Application
Anti-SIRT4 has been used in immunohistochemistry.
Biochem/physiol Actions
SIRT4 (sirtuin 4) may involve in the development of esophageal cancer. Growth of HeLa cells can be suppressed by the overexpression of SIRT4. It modulates glutamine metabolism and may also act as a tumor suppressor. It plays some important roles in multiple cellular processes like stress response and longevity. It may act as an important therapeutic target in colorectal cancer.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Linkage
Corresponding Antigen APREST78151
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.
Legal Information
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
10 - Combustible liquids
WGK
WGK 1
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Certificates of Analysis (COA)
Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Tumour-suppressive function of SIRT4 in human colorectal cancer
Miyo M, et al.
British Journal of Cancer, 113(3), 492-499 (2015)
Kristin A Anderson et al.
Cell metabolism, 25(4), 838-855 (2017-04-06)
Sirtuins are NAD+-dependent protein deacylases that regulate several aspects of metabolism and aging. In contrast to the other mammalian sirtuins, the primary enzymatic activity of mitochondrial sirtuin 4 (SIRT4) and its overall role in metabolic control have remained enigmatic. Using
SIRT4 is upregulated in Chinese patients with esophageal cancer
Lai X, et al.
International Journal of Clinical and Experimental Pathology, 9(10), 10543-10549 (2016)
Zhouxun Chen et al.
OncoTargets and therapy, 12, 2397-2408 (2019-04-18)
SIRT4, a protein localized in the mitochondria, is one of the least characteristic members of the sirtuin family. It is known that SIRT4 has deacetylase activity and plays a role in energy metabolism, but little is known about its possible
β-Cell-specific ablation of sirtuin 4 does not affect nutrient-stimulated insulin secretion in mice.
Frank K Huynh et al.
American journal of physiology. Endocrinology and metabolism, 319(4), E805-E813 (2020-09-01)
Sirtuins are a family of proteins that regulate biological processes such as cellular stress and aging by removing posttranslational modifications (PTMs). We recently identified several novel PTMs that can be removed by sirtuin 4 (SIRT4), which is found in mitochondria.
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service