Skip to Content
Merck
All Photos(1)

Key Documents

AV43788

Sigma-Aldrich

Anti-SLC25A29 antibody produced in rabbit

IgG fraction of antiserum

Synonym(s):

Anti-C14orf69, Anti-FLJ38975, Anti-Solute carrier family 25, member 29

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

33 kDa

species reactivity

human, bovine, dog, rabbit, guinea pig, horse, rat, mouse

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

Gene Information

Immunogen

Synthetic peptide directed towards the C terminal region of human SLC25A29

Biochem/physiol Actions

SLC25A29 is a member of solute carrier (SLC) family 25 of transporters also called as mitochondrial carrier family. The members of this family are present in the inner mitochondrial membranes and connect cytoplasmic and mitochondrial matrices. SLC25A29 is involved in the transport of basic amino acids into the mitochondria, protein synthesis and amino acid degradation in mitochondria.

Sequence

Synthetic peptide located within the following region: AEGWRVFTRGLASTLLRAFPVNAATFATVTVVLTYARGEEAGPEGEAVPA

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Vito Porcelli et al.
The Journal of biological chemistry, 289(19), 13374-13384 (2014-03-22)
The human genome encodes 53 members of the solute carrier family 25 (SLC25), also called the mitochondrial carrier family, many of which have been shown to transport carboxylates, amino acids, nucleotides, and cofactors across the inner mitochondrial membrane, thereby connecting
Ferdinando Palmieri
Molecular aspects of medicine, 34(2-3), 465-484 (2012-12-26)
SLC25 is a large family of nuclear-encoded transporters embedded in the inner mitochondrial membrane and in a few cases other organelle membranes. The members of this superfamily are widespread in eukaryotes and involved in numerous metabolic pathways and cell functions.

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service