Skip to Content
Merck
All Photos(1)

Key Documents

AV32388

Sigma-Aldrich

Anti-SIRT3 antibody produced in rabbit

IgG fraction of antiserum

Synonym(s):

Anti-Sirtuin (silent mating type information regulation 2 homolog) 3 (S. cerevisiae)

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

44 kDa

species reactivity

horse, human, dog, rat, mouse

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... SIRT3(23410)

General description

SIRT3 is a mitochondrial sirtuin deacetylase that modulates thermogenesis in brown fat cells. Studies have also reported that SIRT3 regulates the acetylation of mitochondrial lysine.
Rabbit Anti-SIRT3 (AB2) antibody recognizes zebrafish, rabbit, human, rat, canine, and mouse SIRT3.

Immunogen

Synthetic peptide directed towards the middle region of human SIRT3

Application

Rabbit Anti-SIRT3 (AB2) antibody can be used for western blot applications at a concentration of 2.5μg/ml.

Biochem/physiol Actions

SIRT3 is a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been determined; however, yeast sirtuin proteins are known to regulate epigenetic gene silencing and suppress recombination of rDNA. Studies suggest that the human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. The protein encoded by this gene is included in class I of the sirtuin family.

Sequence

Synthetic peptide located within the following region: SGIPDFRSPGSGLYSNLQQYDLPYPEAIFELPFFFHNPKPFFTLAKELYP

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

David B Lombard et al.
Molecular and cellular biology, 27(24), 8807-8814 (2007-10-10)
Homologs of the Saccharomyces cerevisiae Sir2 protein, sirtuins, promote longevity in many organisms. Studies of the sirtuin SIRT3 have so far been limited to cell culture systems. Here, we investigate the localization and function of SIRT3 in vivo. We show
Tong Shi et al.
The Journal of biological chemistry, 280(14), 13560-13567 (2005-01-18)
SIRT3 is one of the seven mammalian sirtuin homologs of the yeast Sir2 gene, which mediates the effect of caloric restriction on life span extension in yeast and Caenorhabditis elegans. Because adipose tissue is essential in energy homeostasis and also

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service