Accéder au contenu
Merck
Toutes les photos(1)

Key Documents

WH0170302M1

Sigma-Aldrich

Monoclonal Anti-ARX antibody produced in mouse

clone 1G2, purified immunoglobulin, buffered aqueous solution

Synonyme(s) :

Anti-ISSX, Anti-MRX36, Anti-MRX54, Anti-MRXS1, Anti-PRTS, Anti-aristaless related homeobox

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(1)

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

mouse

Niveau de qualité

100

Conjugué

unconjugated

Forme d'anticorps

purified immunoglobulin

Type de produit anticorps

primary antibodies

Clone

1G2, monoclonal

Forme

buffered aqueous solution

Espèces réactives

human

Technique(s)

indirect ELISA: suitable

Isotype

IgG2aκ

Numéro d'accès GenBank

NM_139058

Numéro d'accès UniProt

Q96QS3

Conditions d'expédition

dry ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... ARX(170302)

Description générale

This gene is a homeobox-containing gene expressed during development. The expressed protein contains two conserved domains, a C-peptide (or aristaless domain) and the prd-like class homeobox domain. It is a member of the group-II aristaless-related protein family whose members are expressed primarily in the central and/or peripheral nervous system. This gene is thought to be involved in CNS development. Mutations in this gene cause X-linked mental retardation and epilepsy. (provided by RefSeq)

Immunogène

ARX (NP_620689, 1 a.a. ~ 95 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MSNQYQEEGCSERPECKSKSPTLLSSYCIDSILGRRSPCKMRLLGAAQSLPAPLTSRADPEKAVQGSPKSSSAPFEAELHLPPKLRRLYGPGGGR

Actions biochimiques/physiologiques

Aristaless related homeobox (ARX) is a transcriptional repressor but also plays a role as an activator under some conditions. It has important roles in neuronal migration and cell proliferation in the brain.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Informations légales

GenBank is a registered trademark of United States Department of Health and Human Services

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

nwg

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Équipement de protection individuelle

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Distinct DNA binding and transcriptional repression characteristics related to different ARX mutations.
Cho G
Neurogenetics, 13(1), 23-29 (2012)
The c.429_452 duplication of the ARX gene: a unique developmental-model of limb kinetic apraxia.
Curie A
Orphanet Journal of Rare Diseases, 9, 25-25 (2014)
A novel mutation in the aristaless domain of the ARX gene leads to Ohtahara syndrome, global developmental delay, and ambiguous genitalia in males and neuropsychiatric disorders in females.
Eksioglu YZ
Epilepsia, 52(5), 984-992 (2011)
Ginam Cho et al.
Developmental biology, 393(1), 137-148 (2014-06-27)
Mutations in the Aristaless related homeodomain transcription factor (ARX) are associated with a diverse set of X-linked mental retardation and epilepsy syndromes in humans. Although most studies have been focused on its function in the forebrain, ARX is also expressed

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique