Accéder au contenu
Merck
Toutes les photos(2)

Key Documents

WH0057526M4

Sigma-Aldrich

Monoclonal Anti-PCDH19 antibody produced in mouse

clone 2G10, purified immunoglobulin, buffered aqueous solution

Synonyme(s) :

Anti-DKFZp686P1843, Anti-KIAA1313, Anti-protocadherin 19

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.43

Source biologique

mouse

Conjugué

unconjugated

Forme d'anticorps

purified immunoglobulin

Type de produit anticorps

primary antibodies

Clone

2G10, monoclonal

Forme

buffered aqueous solution

Espèces réactives

human

Technique(s)

indirect ELISA: suitable
western blot: 1-5 μg/mL

Isotype

IgG2aκ

Numéro d'accès GenBank

Numéro d'accès UniProt

Conditions d'expédition

dry ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... PCDH19(57526)

Catégories apparentées

Description générale

Protocadherin 19 (PCDH19) is part of the d-protocadherin superfamily. It is expressed in the brain. The gene encoding this calcium-dependent cell adhesion protein is localized on human chromosome Xq22.1.

Immunogène

PCDH19 (NP_065817, 241 a.a. ~ 340 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
RLVPRDVEETDKMNVVSCSSLTSSLNYFDYHQQTLPLGCRRSESTFLNVENQNTRNTSANHIYHHSFNSQGPQQPDLIINGAPLPETENYSFDSNYVNSR

Actions biochimiques/physiologiques

Protocadherin 19 (PCDH19) has been associated with female-specific epilepsy and an X-linked model of neurological disease. It has a role in neuronal organization and migration. PCDH19 is also involved in cell-cell and cell-matrix adhesion.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Informations légales

GenBank is a registered trademark of United States Department of Health and Human Services

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

nwg

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Équipement de protection individuelle

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

The clinical spectrum of female epilepsy patients with PCDH19 mutations in a Chinese population
A. Liu
Clinical Genetics, 91(1) (2017)
Smith Moyra
Unravelling Complexities In Genetics And Genomics: Impact On Diagnosis Counseling And Management (2016)
Characterizing PCDH19 in human induced pluripotent stem cells (iPSCs) and iPSC-derived developing neurons: emerging role of a protein involved in controlling polarity during neurogenesis
Claudia Compagnucci
Oncotarget, 6(29), 26804-26813 (2015)
Male patients affected by mosaic PCDH19 mutations: five new cases
I.M. de Lange
Neurogenetics (2017)

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique