WH0011213M1

Monoclonal Anti-IRAK3 antibody produced in mouse

clone 1A6, purified immunoglobulin, buffered aqueous solution

• Synonyme(s) : Anti-IRAKM, Anti-interleukin-1 receptor-associated kinase 3
• Numéro MDL: MFCD03096976
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: mouse
• Conjugué: unconjugated
• Forme d'anticorps: purified immunoglobulin
• Type de produit anticorps: primary antibodies
• Clone: 1A6, monoclonal
• Forme: buffered aqueous solution
• Espèces réactives: human
• Technique(s): indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotype: IgG1κ
• Numéro d'accès GenBank: BC057800
• Numéro d'accès UniProt: Q9Y616
• Conditions d'expédition: dry ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... IRAK3(11213)

Description

Description générale

Interleukin 1 receptor associated kinase 3 (IRAK3) belongs to the interleukin receptor associated kinase (IRAK) family that is capable of shuttling in and out of the nucleus. It is associated with monocytes and contains a kinase (homology) domain, signature death domain of the IRAK family, and a C-terminal domain. The IRAK3 gene is mapped to human chromosome 12q14.3.

Immunogène

IRAK3 (AAH57800, 497 a.a. ~ 596 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
RIDRMTQKTPFECSQSEVMFLSLDKKPESKRNEEACNMPSSSCEESWFPKYIVPSQDLRPYKVNIDPSSEAPGHSCRSRPVESSCSSKFSWDEYEQYKKE

Actions biochimiques/physiologiques

Interleukin 1 receptor associated kinase 3 (IRAK3) acts as an anti-inflammatory molecule and blocks IRAK-4,-1 signaling. It is also negatively regulated toll-like receptor/interleukin (IL)-1 receptor (Toll/IL-R) immune signal transduction. IRAK3 may be involved in the pathophysiology of the hepatocellular carcinoma.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Informations légales

GenBank is a registered trademark of United States Department of Health and Human Services

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable
• Équipement de protection individuelle: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)