WH0011093M6

Monoclonal Anti-ADAMTS13 antibody produced in mouse

clone 4F12, purified immunoglobulin, buffered aqueous solution

• Synonyme(s) : Anti-ADAM metallopeptidase with thrombospondin type 1 motif, 13, Anti-C9orf8, Anti-DKFZp434C2322, Anti-MGC118899, Anti-MGC118900, Anti-TTP, Anti-VWFCP, Anti-vWFCP
• Code UNSPSC : 12352203

Propriétés

• Source biologique: mouse
• Niveau de qualité: 100
• Conjugué: unconjugated
• Forme d'anticorps: purified immunoglobulin
• Type de produit anticorps: primary antibodies
• Clone: 4F12, monoclonal
• Forme: buffered aqueous solution
• Espèces réactives: human
• Technique(s): indirect ELISA: suitable
• Isotype: IgG2bκ
• Numéro d'accès GenBank: NM_139025
• Numéro d'accès UniProt: Q76LX8
• Conditions d'expédition: dry ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... ADAMTS13(11093)

Description

Description générale

The gene encoding ADAMTS13 is located on human chromosome 9q34.2 and has 29 exons. It is synthesized by the liver.

This gene encodes a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motif) protein family. Members of the family share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains. The enzyme encoded by this gene is the von Willebrand Factor (vWF)-cleaving protease, which is responsible for cleaving at the site of Tyr842-Met843 of the vWF molecule. A deficiency of this enzyme is associated with thrombotic thrombocytopenic purpura. Alternative splicing of this gene generates multiple transcript variants encoding different isoforms. (provided by RefSeq)

Immunogène

ADAMTS13 (NP_620594, 1328 a.a. ~ 1427 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
FINVAPHARIAIHALATNMGAGTEGANASYILIRDTHSLRTTAFHGQQVLYWESESSQAEMEFSEGFLKAQASLRGQYWTLQSWVPEMQDPQSWKGKEGT

Forme physique

Solution in phosphate buffered saline, pH 7.4

Informations légales

GenBank is a registered trademark of United States Department of Health and Human Services

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable
• Équipement de protection individuelle: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)