Accéder au contenu
Merck
Toutes les photos(3)

Principaux documents

WH0007024M1

Sigma-Aldrich

Monoclonal Anti-TFCP2 antibody produced in mouse

clone 3H6, purified immunoglobulin, buffered aqueous solution

Synonyme(s) :

Anti-CP2, Anti-LBP1C, Anti-LSF, Anti-TFCP2C, Anti-transcription factor CP2

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Numéro MDL:
Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

mouse

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

purified immunoglobulin

Type de produit anticorps

primary antibodies

Clone

3H6, monoclonal

Forme

buffered aqueous solution

Espèces réactives

human

Technique(s)

indirect ELISA: suitable
western blot: 1-5 μg/mL

Isotype

IgG2aλ

Numéro d'accès GenBank

Numéro d'accès UniProt

Conditions d'expédition

dry ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... TFCP2(7024)

Immunogène

TFCP2 (AAH03634, 414 a.a. ~ 502 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
KHEDGDSNGTFFVYHAIYLEELTAVELTEKIAQLFSISPCQISQIYKQGPTGIHVLISDEMIQNFQEEACFILDTMKAETNDSYHIILK

Forme physique

Solution in phosphate buffered saline, pH 7.4

Informations légales

GenBank is a registered trademark of United States Department of Health and Human Services

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Équipement de protection individuelle

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Hui Jiang et al.
International journal of clinical and experimental pathology, 7(9), 6024-6031 (2014-10-23)
Colorectal cancer (CRC) is the third most common cancer worldwide and the fourth most common cause of cancer death. Therapy failure was the first cause of death. LSF is a transcription factor regulating gene expression of angiogenesis, tumor invasion and
Emily Cunningham Williams et al.
Human molecular genetics, 23(11), 2968-2980 (2014-01-15)
The disease mechanism of Rett syndrome (RTT) is not well understood. Studies in RTT mouse models have suggested a non-cell-autonomous role for astrocytes in RTT pathogenesis. However, it is not clear whether this is also true for human RTT astrocytes.
Natalia P Kisseljova et al.
European journal of human genetics : EJHG, 22(9), 1117-1123 (2014-01-23)
Mechanisms that regulate attachment of the scaffold/matrix attachment regions (S/MARs) to the nuclear matrix remain largely unknown. We have studied the effect of simple sequence length polymorphism (SSLP), DNA methylation and chromatin organization in an S/MAR implicated in facioscapulohumeral dystrophy

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique